SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene156468

Length: 433 nt

UniGene Fasta

>sp_v3.0_unigene156468
CAGATGCTTGCTTTATTCGTGTAATTGGAAGTGAACTTGTACAGAAATACGTTGGTGAAGGTGCCAGAATGGTCAGAGAGCTTTTCCAAATGGCGAGAACCAAAAAAGCTTGCATTATCTTCTTTGATGAAATTGATGCTGTGGGTGGTGCCAGATTTGATGACGGTGCTGGTGGTGACAATGAAGTGCAACGAACGATGTTGGAATTGATCAATCAGCTGGATGGCTTCGATCCTCGAGGAAATATCAAGGTGCTCATGGCTACAAACAGACCTGACACACTTGACCCAGCTTTGTTGCGTCCAGGAAGACTCGACAGAAAGATCGAATTTGGACTTCCTGATTTGGAGGGACGAACATCAATTTTTCAGATCCATGCACGAACAATGAGTTGCGCACGAGACATCAGATTTGAATTATTGGCAAGACTTTG

Ace file of the UniGene sp_v3.0_unigene156468

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	RecName: Full=26S protease regulatory subunit 7; AltName: Full=26S proteasome AAA-ATPase subunit RPT1; AltName: Full=26S proteasome subunit 7; AltName: Full=Regulatory particle triple-A ATPase subunit 1 dbj\|BAA13021.1\| 26S proteasome ATPase subunit [Spina	-	-	0.0	81%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	89%
Sma3	Proteasomal ATPase	-	-	1.789e-13	-

Source	ECs	Term	Type	e value	Identity
Sma3	Hydrolases, Acting on peptide bonds (peptide hydrolases), Metalloendopeptidases.	EC:3.4.24.-	-	4.494e-18	-
Sma3	Microtubule-severing ATPase.	EC:3.6.4.3	-	3.512e-15	-

Source	Gene names
Sma3	26S proteasome subunit; AAA; AP2_E06.1; AT4g29040; AT5G42270; At1g09100; At1g45000; At1g45000/F27F5.8; At1g50250; At1g53750; At2g20140; At3g05530; At3g05530/F22F7.1; At4g29040; At5g19990; At5g20000; At5g42270; At5g43010; At5g58290; AtSUG1; BrTBP; CHLREDRA

Source	GOs	Term	Type	Identity
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	nucleolus	GO:0005730	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	endoplasmic reticulum	GO:0005783	Cellular Component	-
Sma3	Golgi apparatus	GO:0005794	Cellular Component	-
Sma3	cytosol	GO:0005829	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	chloroplast thylakoid membrane	GO:0009535	Cellular Component	-
Sma3	thylakoid	GO:0009579	Cellular Component	-
Sma3	chloroplast envelope	GO:0009941	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	thylakoid lumen	GO:0031977	Cellular Component	-
Sma3	protein complex	GO:0043234	Cellular Component	-
Sma3	ATP-dependent peptidase activity	GO:0004176	Molecular Function	-
Sma3	metalloendopeptidase activity	GO:0004222	Molecular Function	-
Sma3	serine-type endopeptidase activity	GO:0004252	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	peptidase activity	GO:0008233	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	nucleoside-triphosphatase activity	GO:0017111	Molecular Function	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	intracellular protein transport	GO:0006886	Biological Process	-
Sma3	cell cycle	GO:0007049	Biological Process	-
Sma3	multicellular organismal development	GO:0007275	Biological Process	-
Sma3	photosystem II repair	GO:0010206	Biological Process	-
Sma3	PSII associated light-harvesting complex II catabolic process	GO:0010304	Biological Process	-
Sma3	protein catabolic process	GO:0030163	Biological Process	-
Sma3	cell division	GO:0051301	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidase M41	IPR000642	-	-
Sma3	NSF attachment protein	IPR000744	-	-
Sma3	Chaperonin ClpA/B	IPR001270	-	-
Sma3		IPR001984	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	ATPase, AAA-type, core	IPR003959	-	-
Sma3	ATPase, AAA-type, conserved site	IPR003960	-	-
Sma3	Peptidase, FtsH	IPR005936	-	-
Sma3	26S proteasome subunit P45	IPR005937	-	-
Sma3	Peptidase M41, FtsH extracellular	IPR011546	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-

Source	Species	ID	Description	Identity
ATG	Arabidoptis thaliana	AT1G53750.1	RPT1A regulatory particle triple-A 1A chr1:20065921-20068324 REVERSE LENGTH=426	89%
RefSeq	Arabidopsis thaliana	NP_175778.1	regulatory particle triple-A 1A [Arabidopsis thaliana]	89%
RefSeq	Populus trichocarpa	XP_002334015.1	predicted protein, partial [Populus trichocarpa]	89%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LL88

Fln msg: Distance to subject end: 56 aas, your sequence is shorter than subject: 143 - 425

Fln protein: DACFIRVIGSELVQKYVGEGARMVRELFQMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALLRPGRLDRKIEFGLPDLEGRTSIFQIHARTMSCARDIRFELLARL

Protein Length: 144

Fln nts: CAGATGCTTGCTTTATTCGTGTAATTGGAAGTGAACTTGTACAGAAATACGTTGGTGAAGGTGCCAGAATGGTCAGAGAGCTTTTCCAAATGGCGAGAACCAAAAAAGCTTGCATTATCTTCTTTGATGAAATTGATGCTGTGGGTGGTGCCAGATTTGATGACGGTGCTGGTGGTGACAATGAAGTGCAACGAACGATGTTGGAATTGATCAATCAGCTGGATGGCTTCGATCCTCGAGGAAATATCAAGGTGCTCATGGCTACAAACAGACCTGACACACTTGACCCAGCTTTGTTGCGTCCAGGAAGACTCGACAGAAAGATCGAATTTGGACTTCCTGATTTGGAGGGACGAACATCAATTTTTCAGATCCATGCACGAACAATGAGTTGCGCACGAGACATCAGATTTGAATTATTGGCAAGACTTTG

Fln Alignment:

HLKU4M004IGI5N___DACFIRVIGSELVQKYVGEGARMVRELFQMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALLRPGRLDRKIEFGLPDLEGRTSIFQIHARTMSCARDIRFELLARL
B8LL88________________DACFIRVIGSELVQKYVGEGARMVRELFQMARSKKACIVFFDEVDAIGGARFDDGLGGDNEVQRTMLEIVNQLDGFDARGNIKVLMATNRPDTLDPALLRPGRLDRKVEFGLPDLESRTQIFKIHTRTMNCERDIRFELLARL

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain