UniGene Name: sp_v3.0_unigene156353
Length: 155 nt
![]() |
---|
>sp_v3.0_unigene156353
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Calreticulin, putative n=4 Tax=Entamoeba RepID=B0ETB7_ENTDI | - | - | 1.0e-11 | 63% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 72% |
Sma3 | Calreticulin | - | - | 8.29569e-43 | - |
Source | Gene names |
---|---|
Sma3 | AT1G56340; At1g09210; At1g56340; At5g61790; CAL1; CHLREDRAFT_78954; CNX; CNX1; CRH; CRH1; CRH2; CRT; CRT1; CRT2; CRTL; Crt1; F13N6.20; F14G9.5; GSVIVT00006229001; GSVIVT00011650001; GSVIVT00022619001; GSVIVT00028103001; Gm cnx-1; Gm crt-1; LOC_Os03g61670; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum lumen | GO:0005788 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | unfolded protein binding | GO:0051082 | Molecular Function | 0.0 | - |
Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Calreticulin/calnexin | IPR001580 | - | 0.0 | - |
Sma3 | Calreticulin/calnexin, P | IPR009033 | - | 0.0 | - |
Sma3 | Calreticulin | IPR009169 | - | 0.0 | - |
Sma3 | Concanavalin A-like lectin/glucanase, subgroup | IPR013320 | - | 0.0 | - |
Sma3 | Calreticulin/calnexin, conserved site | IPR018124 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G56340.1 | CRT1, CRT1a, AtCRT1a calreticulin 1a chr1:21090059-21092630 REVERSE LENGTH=425 | 4.0e-12 | 74% |
RefSeq | Arabidopsis thaliana | NP_001031199.1 | calreticulin-1 [Arabidopsis thaliana] | 5.0e-12 | 74% |
RefSeq | Populus trichocarpa | XP_002318957.1 | predicted protein [Populus trichocarpa] | 5.0e-11 | 70% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LP55
Fln msg: Distance to subject end: 104 aas, your sequence is shorter than subject: 51 - 401
Fln protein:
K
Protein Length:
52
Fln nts:
T
Fln Alignment:
HLKU4M004JE4IK___DPDAKKPXXXXXXXXXXXXAPLIDNPEYKGEWKAAKIPNPAYKGEWVHPL
B8LP55________________DSDATKPEDWDDEEDGEWKAPTIPNPEYKGPWKPKKIKNPKYKGKWVAPM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain