UniGene Name: sp_v3.0_unigene156294
Length: 223 nt
UniGene Fasta |
---|
>sp_v3.0_unigene156294
G |
Ace file of the UniGene sp_v3.0_unigene156294 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15/PRP43 [Arabidopsis thaliana] emb|CAB82945.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana] gb|AAM53340.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana] gb|AAQ56774 | - | - | 4.0e-24 | 66% |
FL-Next | sp=Probable pre-mRNA-splicing factor ATP-dependent RNA helicase; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 66% |
Source | Gene names |
---|---|
Sma3 | At2g47250; At3g62310; At5g14900; F2G14_20; GSVIVT00028144001; LOC_Os03g19960; MICPUCDRAFT_24785; MICPUN_51830; OSTLU_12120; OsI_11295; OsJ_10612; Ot01g03060; PHYPADRAFT_176656; PHYPADRAFT_204131; PHYPADRAFT_227553; POPTRDRAFT_774677; POPTRDRAFT_799231; RC |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | helicase activity | GO:0004386 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
Sma3 | mRNA processing | GO:0006397 | Biological Process | 0.0 | - |
Sma3 | RNA splicing | GO:0008380 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
Sma3 | DNA/RNA helicase, ATP-dependent, DEAH-box type, conserved site | IPR002464 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | Helicase-associated domain | IPR007502 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF1605 | IPR011709 | - | 0.0 | - |
Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
Sma3 | IPR014021 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G62310.1 | RNA helicase family protein chr3:23057516-23060561 REVERSE LENGTH=726 | 3.0e-30 | 66% |
RefSeq | Arabidopsis thaliana | NP_191790.1 | pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15/PRP43 [Arabidopsis thaliana] | 3.0e-30 | 66% |
RefSeq | Populus trichocarpa | XP_002320963.1 | predicted protein [Populus trichocarpa] | 2.0e-31 | 68% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: O22899
Fln msg: Distance to subject end: 92 aas, your sequence is shorter than subject: 74 - 729
Fln protein:
A
Protein Length:
75
Fln nts:
G
Fln Alignment:
HLKU4M004JFB2F___AYKKNADDRTWCYDNFLNHRSMKAADNVRTQLSRIMRRFNLPLVSTEFNSPDYYLNLRKALVAGFFMQAAHLER
O22899________________AYKQNNEDPNWCFENFVNNRAMKSADNVRQQLVRIMSRFNLKMCSTDFNSRDYYVNIRKAMLAGYFMQVAHLER
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain