|
||||||
|
UniGene Name: sp_v3.0_unigene156110
Length: 235 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene156110
T |
|
Ace file of the UniGene sp_v3.0_unigene156110
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | RAB GTPase-like protein C2B [Arabidopsis thaliana] ref|NP_001189850.1| RAB GTPase-like protein C2B [Arabidopsis thaliana] ref|NP_001189851.1| RAB GTPase-like protein C2B [Arabidopsis thaliana] sp|Q9SF92.1|RAC2B_ARATH RecName: Full=Ras-related protein RABC | - | - | 9.0e-21 | 59% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 59% |
| Sma3 | Rab18/RabC-family small GTPase | - | - | 2.68e-20 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Sphingomyelin phosphodiesterase. | EC:3.1.4.12 | - | 4.629e-16 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Sphingolipid metabolism | 00600 | 4.629e-16 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.629e-16 | % |
| Source | Gene names |
|---|---|
| Sma3 | 24.t00078; 26.t00059; 27.t00047; 40.t00023; ARA-5; AT4g17530; AT5g47200/MQL5_5; ATFP8; At1g02130; At1g43890; At3g09910; At3g11730; At4g17530; At5g03530; At5g47200; At5g47201; AtRAB18; AtRab; CHLREDRAFT_60490; F12E4_310; F26K24.2; F28H19.15; F8A24.4; GSVIV |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Golgi membrane | GO:0000139 | Cellular Component | 0.0 | - |
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
| Sma3 | transcription factor binding | GO:0008134 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | ER to Golgi vesicle-mediated transport | GO:0006888 | Biological Process | 0.0 | - |
| Sma3 | small GTPase mediated signal transduction | GO:0007264 | Biological Process | 0.0 | - |
| Sma3 | protein transport | GO:0015031 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein phosphatase 2C, manganese/magnesium aspartate binding site | IPR000222 | - | 0.0 | - |
| Sma3 | Major sperm protein | IPR000535 | - | 0.0 | - |
| Sma3 | Small GTPase superfamily | IPR001806 | - | 0.0 | - |
| Sma3 | Protein phosphatase 2C-like | IPR001932 | - | 0.0 | - |
| Sma3 | RNA polymerase sigma factor 54, interaction | IPR002078 | - | 0.0 | - |
| Sma3 | Transcription factor, MADS-box | IPR002100 | - | 0.0 | - |
| Sma3 | IPR003577 | - | 0.0 | - | |
| Sma3 | Small GTPase superfamily, Rab type | IPR003579 | - | 0.0 | - |
| Sma3 | Glutathione S-transferase, N-terminal | IPR004045 | - | 0.0 | - |
| Sma3 | Small GTP-binding protein domain | IPR005225 | - | 0.0 | - |
| Sma3 | PapD-like | IPR008962 | - | 0.0 | - |
| Sma3 | IPR012335 | - | 0.0 | - | |
| Sma3 | IPR013753 | - | 0.0 | - | |
| Sma3 | IPR014045 | - | 0.0 | - | |
| Sma3 | IPR015595 | - | 0.0 | - | |
| Sma3 | IPR015598 | - | 0.0 | - | |
| Sma3 | Protein phosphatase 2C | IPR015655 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G09910.1 | ATRAB18C, ATRABC2B, RABC2b RAB GTPase homolog C2B chr3:3036864-3038121 REVERSE LENGTH=205 | 6.0e-28 | 59% |
| RefSeq | Arabidopsis thaliana | NP_001189850.1 | RAB GTPase-like protein C2B [Arabidopsis thaliana] | 7.0e-28 | 59% |
| RefSeq | Populus trichocarpa | XP_002316401.1 | predicted protein [Populus trichocarpa] | 1.0e-28 | 62% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NMY5
Fln msg: Distance to subject end: 68 aas, your sequence is shorter than subject: 77 - 208
Fln protein:
N
Protein Length:
78
Fln nts:
T
Fln Alignment:
HLKU4M004JJQG3___LTIWDTAGQEKFWSLTSSYYRGTHGVILVFDLTAKRTFEHLS-LWLKEIDLYTNDSNVVKLLVGNKADRESEREIEK
A9NMY5________________LTIWDTAGQERFRTLTSSYYRGAQGIIFVYDVTRRETFTNLSEVWAKEVDLYSTNQDCIKMLVGNKVDRETERVVSK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
