SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene155975

Length: 281 nt

UniGene Fasta

>sp_v3.0_unigene155975
ACAGGATAATTAAAGGATTTATGGTTCAGGGTGGAGACTTTATAAACGGTAATGGAACAGGCAGCATGAGCATTTATGGAGAAAAATTTCCTGATGAAAACTTTAGTCTCAAGCACACTGAGCCAGGCTTGCTATCAATGGCCAATAGTGGCTCCAATTCGAACGGCTGCCAATTTTTCATTACCTGCGAAGCAGCGGACTGGCTGGATAATAAGCACGTCGTCTTTGGCAAAGTGATTGAGGACGGCCTGCGCGTCGTGCGAATGATAGAGAACGTGTCT

Ace file of the UniGene sp_v3.0_unigene155975

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Peptidyl-prolyl cis-trans isomerase n=2 Tax=Chlamydomonadales RepID=A8IVQ7_CHLRE	-	-	4.0e-36	73%
FL-Next	sp=Peptidyl-prolyl cis-trans isomerase; Pseudotsuga menziesii (Douglas-fir) (Abies menziesii).	-	-	0.0	68%
Sma3	Peptidyl-prolyl cis-trans isomerase	-	-	0.0	-

Source	ECs	Term	Type	e value	Identity
Sma3	Peptidylprolyl isomerase.	EC:5.2.1.8	-	0.0	-

Source	Gene names
Sma3	43H1; 46C02.10; 56B23-g9; AT3G63400; At2g15790; At2g16600; At2g21130; At2g29960; At2g38730; At3g55920; At3g56070; At3g62030; At3g63400; At4g34870; At4g38740; At5g13120; At5g58710; B1331F11.9; CHLREDRAFT_183823; CHLREDRAFT_185571; CHLREDRAFT_196289; CHLRED

Source	GOs	Term	Type	Identity
Sma3	extracellular region	GO:0005576	Cellular Component	-
Sma3	membrane fraction	GO:0005624	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	multivesicular body	GO:0005771	Cellular Component	-
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	endoplasmic reticulum	GO:0005783	Cellular Component	-
Sma3	Golgi stack	GO:0005795	Cellular Component	-
Sma3	cytosol	GO:0005829	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	chloroplast thylakoid membrane	GO:0009535	Cellular Component	-
Sma3	chloroplast stroma	GO:0009570	Cellular Component	-
Sma3	chloroplast envelope	GO:0009941	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	cytosolic ribosome	GO:0022626	Cellular Component	-
Sma3	thylakoid lumen	GO:0031977	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	peptidyl-prolyl cis-trans isomerase activity	GO:0003755	Molecular Function	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	peptide binding	GO:0042277	Molecular Function	-
Sma3	protein folding	GO:0006457	Biological Process	-
Sma3	response to oxidative stress	GO:0006979	Biological Process	-
Sma3	RNA splicing	GO:0008380	Biological Process	-
Sma3	plant-type hypersensitive response	GO:0009626	Biological Process	-
Sma3	response to light intensity	GO:0009642	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-
Sma3	vegetative phase change	GO:0010050	Biological Process	-
Sma3	response to mannitol stimulus	GO:0010555	Biological Process	-
Sma3	floral meristem determinacy	GO:0010582	Biological Process	-
Sma3	cysteine biosynthetic process	GO:0019344	Biological Process	-
Sma3	defense response to bacterium	GO:0042742	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidyl-prolyl cis-trans isomerase, FKBP-type, domain	IPR001179	-	-
Sma3	Tetratricopeptide TPR-1	IPR001440	-	-
Sma3	Cyclophilin-like peptidyl-prolyl cis-trans isomerase domain	IPR002130	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-
Sma3	Tetratricopeptide repeat-containing domain	IPR013026	-	-
Sma3	Tetratricopeptide repeat	IPR019734	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G38730.1	Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein chr2:16192579-16194038 REVERSE LENGTH=199	5.60519e-45	72%
RefSeq	Arabidopsis thaliana	NP_181407.1	peptidyl-prolyl isomerase H (cyclophilin H) [Arabidopsis thaliana]	7.00649e-45	72%
RefSeq	Populus trichocarpa	XP_002304808.1	predicted protein [Populus trichocarpa]	9.80909e-45	70%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: Q9ZRQ9

Fln msg: Distance to subject end: 19 aas, your sequence is shorter than subject: 93 - 189

Fln protein: RIIKGFMVQGGDFINGNGTGSMSIYGEKFPDENFSLKHTEPGLLSMANSGSNSNGCQFFITCEAADWLDNKHVVFGKVIEDGLRVVRMIENVS

Protein Length: 94

Fln nts: ACAGGATAATTAAAGGATTTATGGTTCAGGGTGGAGACTTTATAAACGGTAATGGAACAGGCAGCATGAGCATTTATGGAGAAAAATTTCCTGATGAAAACTTTAGTCTCAAGCACACTGAGCCAGGCTTGCTATCAATGGCCAATAGTGGCTCCAATTCGAACGGCTGCCAATTTTTCATTACCTGCGAAGCAGCGGACTGGCTGGATAATAAGCACGTCGTCTTTGGCAAAGTGATTGAGGACGGCCTGCGCGTCGTGCGAATGATAGAGAACGTGTCT

Fln Alignment:

HLKU4M004IXMXA___RIIKGFMVQGGDFINGNGTGSMSIYGEKFPDENFSLKHTEPGLLSMANSGSNSNGCQFFITCEAADWLDNKHVVFGKVIEDGLRVVRMIENV
Q9ZRQ9________________RVIKDFMIQAGDFVKGDGSGCISIYGSKFEDENFIAKHTGPGLLSMANSGPNTNGSQFFLTCAKCDWLDNKHVVFGRVLGEGLLVLRKIENV

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain