UniGene Name: sp_v3.0_unigene155601
Length: 159 nt
UniGene Fasta |
---|
>sp_v3.0_unigene155601
C |
Ace file of the UniGene sp_v3.0_unigene155601 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | PREDICTED: similar to UDP-glucose pyrophosphorylase [Strongylocentrotus purpuratus] | - | - | 8.0e-12 | 62% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 60% |
Sma3 | UDP-glucose pyrophosphorylase | - | - | 6.199e-14 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | UTP--glucose-1-phosphate uridylyltransferase. | EC:2.7.7.9 | - | 1.578e-18 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Pentose and glucuronate interconversions | 00040 | 1.578e-18 | % | |
Sma3 | Galactose metabolism | 00052 | 1.578e-18 | % | |
Sma3 | Starch and sucrose metabolism | 00500 | 1.578e-18 | % | |
Sma3 | Amino sugar and nucleotide sugar metabolism | 00520 | 1.578e-18 | % | |
Sma3 | Metabolic pathways | 01100 | 1.578e-18 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.578e-18 | % |
Source | Gene names |
---|---|
Sma3 | At3g03250; At5g17310; MKP11.16; RCOM_1605130; T17B22.6; UGP; ugp; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | UTP:glucose-1-phosphate uridylyltransferase activity | GO:0003983 | Molecular Function | 0.0 | - |
Sma3 | nucleotidyltransferase activity | GO:0016779 | Molecular Function | 0.0 | - |
Sma3 | sucrose metabolic process | GO:0005985 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | cellular response to phosphate starvation | GO:0016036 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | UTP--glucose-1-phosphate uridylyltransferase | IPR002618 | - | 0.0 | - |
Sma3 | UTP--glucose-1-phosphate uridylyltransferase, subgroup | IPR016267 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G03250.1 | UGP, UGP1, AtUGP1 UDP-GLUCOSE PYROPHOSPHORYLASE 1 chr3:749761-754014 REVERSE LENGTH=469 | 6.0e-16 | 62% |
RefSeq | Arabidopsis thaliana | NP_850837.1 | UTP--glucose-1-phosphate uridylyltransferase 1 [Arabidopsis thaliana] | 5.0e-16 | 62% |
RefSeq | Populus trichocarpa | XP_002336455.1 | predicted protein [Populus trichocarpa] | 2.0e-15 | 58% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LRA3
Fln msg: Distance to subject end: 151 aas, your sequence is shorter than subject: 53 - 236
Fln protein:
L
Protein Length:
54
Fln nts:
C
Fln Alignment:
HLKU4M004JR9IV___LLEIAQVPKEHLNDFTSVKKFKVFNTNNLWVKLSAIEKFIENGNFTKMDVILN
B8LRA3________________LLEIAQVPKEHVGEFKSIEKFKIFNTNNLWVNLKAIKRLVE-ADALKMEIIPN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain