UniGene Name: sp_v3.0_unigene155084
Length: 226 nt
UniGene Fasta |
---|
>sp_v3.0_unigene155084
T |
Ace file of the UniGene sp_v3.0_unigene155084 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | 40S ribosomal protein S4, putative n=1 Tax=Pediculus humanus corporis RepID=E0W344_PEDHC | - | - | 1.0e-21 | 71% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 60% |
Sma3 | 40S ribosomal protein S4 | - | - | 1.646e-20 | - |
Source | Gene names |
---|---|
Sma3 | AT5G07090; At2g17360; At5g07090; At5g58420; BiRP1; CHLREDRAFT_188837; F5J6.12; GSVIVT00001285001; MICPUCDRAFT_36856; MICPUN_90851; MOJ9.26; MQJ2_10; OJ1393_A07.10; OSTLU_18526; Os01g0358400; Os02g0105900; Os05g0368300; OsI_01884; OsI_05494; OsI_19685; OsJ |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
Sma3 | cytosolic small ribosomal subunit | GO:0022627 | Cellular Component | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | rRNA binding | GO:0019843 | Molecular Function | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribosomal protein S4e | IPR000876 | - | 0.0 | - |
Sma3 | RNA-binding S4 domain | IPR002942 | - | 0.0 | - |
Sma3 | KOW | IPR005824 | - | 0.0 | - |
Sma3 | Ribosomal protein S4e, N-terminal | IPR013843 | - | 0.0 | - |
Sma3 | Ribosomal protein S4e, central | IPR013845 | - | 0.0 | - |
Sma3 | Ribosomal protein S4e, N-terminal, conserved site | IPR018199 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G58420.1 | Ribosomal protein S4 (RPS4A) family protein chr5:23619599-23620896 FORWARD LENGTH=262 | 8.0e-22 | 55% |
RefSeq | Arabidopsis thaliana | NP_200650.1 | 40S ribosomal protein S4-3 [Arabidopsis thaliana] | 1.0e-21 | 55% |
RefSeq | Populus trichocarpa | XP_002323021.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-22 | 55% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NNW1
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 61 aas, your sequence is shorter than subject: 75 - 263
Fln protein:
P
Protein Length:
76
Fln nts:
T
Fln Alignment:
HLKU4M004I2K32___KKVPFIVTHDGRTIRYPDPSIKVDDTVKVEIETGKILGFTKFESGKLAMITKGRNTGRVGTILHVEKH
A9NNW1________________KGIPYLNTYDGRTIRYPDPLVKANDTIKVDLETGKIKEFIKFDVGNVIMVTGGRNRGRVGVIKHREKH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain