|
||||||
|
UniGene Name: sp_v3.0_unigene154797
Length: 210 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene154797
A |
|
Ace file of the UniGene sp_v3.0_unigene154797 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cyclin-dependent kinase 1 n=2 Tax=Dictyostelium RepID=CDK1_DICDI | - | - | 4.0e-17 | 65% |
| FL-Next | tr=Cdc2Pa protein; Picea abies (Norway spruce) (Picea excelsa). | - | - | 0.0 | 57% |
| Sma3 | CDKA | - | - | 9.075e-12 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cyclin-dependent kinase. | EC:2.7.11.22 | - | 8.094e-18 | - |
| Sma3 | [RNA-polymerase]-subunit kinase. | EC:2.7.11.23 | - | 4.336e-17 | - |
| Source | Gene names |
|---|---|
| Sma3 | At3g48750; CDC2; CDC2-1; CDC2-2; CDC2A; CDC2B; CDK-A; CDK34; CDKA; CDKA-1; CDKA-2; CDKA1; CDKA2; CHLREDRAFT_127285; Cdc2a; CdkA; CdkA:4; GSVIVT00000820001; ISOCDC2; LOC_Os02g03060; LOC_Os03g02680; OSTLU_49332; Os02g0123100; Os03g0118400; OsI_05651; OsI_09 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | preprophase band | GO:0009574 | Cellular Component | 0.0 | - |
| Sma3 | cortical microtubule, transverse to long axis | GO:0010005 | Cellular Component | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | cyclin-dependent protein kinase activity | GO:0004693 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | RNA polymerase II carboxy-terminal domain kinase activity | GO:0008353 | Molecular Function | 0.0 | - |
| Sma3 | cytokinesis | GO:0000910 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | mitosis | GO:0007067 | Biological Process | 0.0 | - |
| Sma3 | positive regulation of cell proliferation | GO:0008284 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | pollen development | GO:0009555 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | DNA endoreduplication | GO:0042023 | Biological Process | 0.0 | - |
| Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Hydroxymethylglutaryl-coenzyme A synthase, N-terminal | IPR013528 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G48750.1 | " CDKA;1, CDC2AAT, CDK2, CDC2, CDC2A, CDKA1 cell division control 2 chr3:18072238-18074296 FORWARD LENGTH=294" | 5.0e-20 | 56% |
| RefSeq | Arabidopsis thaliana | NP_566911.1 | cyclin-dependent kinase A-1 [Arabidopsis thaliana] | 6.0e-20 | 56% |
| RefSeq | Populus trichocarpa | XP_002306004.1 | hypothetical protein POPTRDRAFT_648419 [Populus trichocarpa] | 6.0e-21 | 58% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q43361
Fln msg: Distance to subject end: 149 aas, your sequence is shorter than subject: 69 - 294
Fln protein:
Q
Protein Length:
70
Fln nts:
A
Fln Alignment:
HLKU4M004JX2TQ___QRRLYLVFEYLDKDLKQHMDSVASIP--PATVKLWTKQLLEGLMFCHTRRIIHRDLKPQNLLIDR--FGLKLA
Q43361________________EKRLYLVFEYLDLDLKKHMDSCPELAKDPRLIKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRKTNALKLA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
