SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene154254

Length: 281 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene154254
AAGAGATACACAAGCTGTAGCTGAAAAATTAATTGAAGATGGATATAGCGCTGCTGCGTTGCACGGAGATTTATCTCAGGCACAACGTGATGGTGTAATGAAATCTTTCCGTGGAAGACAAATTCAGATGCTTGTTGCTACTGACGTTGCTGCACGTGGAATTGACGTTGATAACGTAACACACGTTGTAAACTACCAATTACCTGATGAAATCGAAACGTACAACCACCGTTCTGGACGTACTGGAAGAGCTGGAAAATTAGGAACTTCTATTGTAATTG

Ace file of the UniGene sp_v3.0_unigene154254 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	DEAD/DEAH box helicase domain protein n=1 Tax=Flavobacterium johnsoniae UW101 RepID=A5FH88_FLAJ1	-	-	1.4013e-45	100%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	46%
Sma3	Dead box ATP-dependent RNA helicase, putative	-	-	6.818e-11	-

Source	ECs	Term	Type	e value	Identity
Sma3	Hydrolases, Acting on acid anhydrides, In phosphorous-containing anhydrides.	EC:3.6.1.-	-	1.91e-18	-

Source	KEGGs	Term	e value	Identity
Sma3	Purine metabolism	00230	1.91e-18	%
Sma3	Lipopolysaccharide biosynthesis	00540	1.91e-18	%
Sma3	Folate biosynthesis	00790	1.91e-18	%
Sma3	Metabolic pathways	01100	1.91e-18	%

Source	Gene names
Sma3	At3g01540; At3g22310; At3g22330; At5g14610; CHLREDRAFT_104111; CHLREDRAFT_111269; CHLREDRAFT_119793; CHLREDRAFT_131102; DRH1; F4P13.9; GSVIVT00019684001; GSVIVT00022481001; GSVIVT00023931001; GSVIVT00035915001; LOC_Os01g07740; LOC_Os03g50090; LOC_Os03g612

Source	GOs	Term	Type	Identity
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	nucleolus	GO:0005730	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	ATP-dependent RNA helicase activity	GO:0004004	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	ATP-dependent helicase activity	GO:0008026	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	GO:0000184	Biological Process	-
Sma3	rRNA processing	GO:0006364	Biological Process	-
Sma3	response to cold	GO:0009409	Biological Process	-
Sma3	response to water deprivation	GO:0009414	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Regulator of chromosome condensation, RCC1	IPR000408	-	-
Sma3	RNA helicase, ATP-dependent, DEAD-box, conserved site	IPR000629	-	-
Sma3	WW/Rsp5/WWP	IPR001202	-	-
Sma3	Helicase, C-terminal	IPR001650	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	DNA/RNA helicase, DEAD/DEAH box type, N-terminal	IPR011545	-	-
Sma3	GUCT	IPR012562	-	-
Sma3	Helicase, superfamily 1/2, ATP-binding domain	IPR014001	-	-
Sma3	RNA helicase, DEAD-box type, Q motif	IPR014014	-	-
Sma3		IPR014021	-	-
Sma3	Aldehyde dehydrogenase, conserved site	IPR016160	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT3G22310.1	PMH1, ATRH9 putative mitochondrial RNA helicase 1 chr3:7887382-7889806 FORWARD LENGTH=610	8.0e-25	53%
RefSeq	Arabidopsis thaliana	NP_188870.1	DEAD-box ATP-dependent RNA helicase 9 [Arabidopsis thaliana]	1.0e-24	53%
RefSeq	Populus trichocarpa	XP_002317866.1	predicted protein [Populus trichocarpa]	6.0e-24	48%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: D5A7Y4

Fln msg: Distance to subject end: 54 aas, your sequence is shorter than subject: 93 - 259

Fln protein: RDTQAVAEKLIEDGYSAAALHGDLSQAQRDGVMKSFRGRQIQMLVATDVAARGIDVDNVTHVVNYQLPDEIETYNHRSGRTGRAGKLGTSIVI

Protein Length: 94

Fln nts: AAGAGATACACAAGCTGTAGCTGAAAAATTAATTGAAGATGGATATAGCGCTGCTGCGTTGCACGGAGATTTATCTCAGGCACAACGTGATGGTGTAATGAAATCTTTCCGTGGAAGACAAATTCAGATGCTTGTTGCTACTGACGTTGCTGCACGTGGAATTGACGTTGATAACGTAACACACGTTGTAAACTACCAATTACCTGATGAAATCGAAACGTACAACCACCGTTCTGGACGTACTGGAAGAGCTGGAAAATTAGGAACTTCTATTGTAATTG

Fln Alignment:

HLKU4M004I59ZU___RDTQAVAEKLIEDGYSAAALHGDLSQAQRDGVMKSFRGRQIQMLVATDVAARGIDVDNVTHVVNYQLPDEIETYNHRSGRTGRAGKLGTS
D5A7Y4________________KTADSLARHLDKVGYRVTTLHGGKTQEQREISLEGFRNKRYNILVATDVAGRGIDIPDVAHVINFDMPSNIEMYTHRIGRTGRAGKTGVA

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain