UniGene Name: sp_v3.0_unigene152577
Length: 248 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene152577
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Peptidyl-prolyl cis-trans isomerase n=1 Tax=Selaginella moellendorffii RepID=D8RE87_SELML | - | - | 2.0e-33 | 85% |
FL-Next | sp=Peptidyl-prolyl cis-trans isomerase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 79% |
Sma3 | Peptidyl-prolyl cis-trans isomerase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidylprolyl isomerase. | EC:5.2.1.8 | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | 43H1; AT3G63400; At2g21130; At2g29960; At2g36130; At3g44600; At3g44600/F14L2_150; At3g55920; At3g56070; At3g63400; At4g34870; At4g38740; At5g13120; B1331F11.9; CHLREDRAFT_132902; CHLREDRAFT_185571; CHLREDRAFT_196289; CHLREDRAFT_196565; CHLREDRAFT_30209; C |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | membrane fraction | GO:0005624 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | multivesicular body | GO:0005771 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | Golgi stack | GO:0005795 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | thylakoid lumen | GO:0031977 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | peptidyl-prolyl cis-trans isomerase activity | GO:0003755 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | peptide binding | GO:0042277 | Molecular Function | 0.0 | - |
Sma3 | histone binding | GO:0042393 | Molecular Function | 0.0 | - |
Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
Sma3 | RNA splicing | GO:0008380 | Biological Process | 0.0 | - |
Sma3 | plant-type hypersensitive response | GO:0009626 | Biological Process | 0.0 | - |
Sma3 | regulation of flower development | GO:0009909 | Biological Process | 0.0 | - |
Sma3 | meristem structural organization | GO:0009933 | Biological Process | 0.0 | - |
Sma3 | regulation of root meristem growth | GO:0010082 | Biological Process | 0.0 | - |
Sma3 | leaf vascular tissue pattern formation | GO:0010305 | Biological Process | 0.0 | - |
Sma3 | leaf formation | GO:0010338 | Biological Process | 0.0 | - |
Sma3 | leaf shaping | GO:0010358 | Biological Process | 0.0 | - |
Sma3 | regulation of histone methylation | GO:0031060 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | carpel development | GO:0048440 | Biological Process | 0.0 | - |
Sma3 | stamen development | GO:0048443 | Biological Process | 0.0 | - |
Sma3 | sepal formation | GO:0048453 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
Sma3 | Peptidyl-prolyl cis-trans isomerase, FKBP-type, domain | IPR001179 | - | 0.0 | - |
Sma3 | Tetratricopeptide TPR-1 | IPR001440 | - | 0.0 | - |
Sma3 | WD40 repeat | IPR001680 | - | 0.0 | - |
Sma3 | Cyclophilin-like peptidyl-prolyl cis-trans isomerase domain | IPR002130 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Tetratricopeptide repeat-containing domain | IPR013026 | - | 0.0 | - |
Sma3 | mRNA splicing factor SYF2 | IPR013260 | - | 0.0 | - |
Sma3 | WD40/YVTN repeat-like-containing domain | IPR015943 | - | 0.0 | - |
Sma3 | WD40-repeat-containing domain | IPR017986 | - | 0.0 | - |
Sma3 | Tetratricopeptide repeat | IPR019734 | - | 0.0 | - |
Sma3 | IPR019782 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G36130.1 | Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein chr2:15166863-15168259 FORWARD LENGTH=164 | 7.0e-40 | 75% |
RefSeq | Arabidopsis thaliana | NP_181157.1 | peptidyl-prolyl cis-trans isomerase-like 1 [Arabidopsis thaliana] | 8.99999e-40 | 75% |
RefSeq | Populus trichocarpa | XP_002322812.1 | predicted protein [Populus trichocarpa] | 5.0e-39 | 74% |
![]() |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NNI6
Fln msg: STOP codon was not found. Distance to subject end: 13 aas, your sequence is shorter than subject: 82 - 163
Fln protein:
G
Protein Length:
83
Fln nts:
G
Fln Alignment:
HLKU4M004JCM2A___GGQSIYGTPFEDELTRELKHTGAGVLSMANSGPNTNGSQFFISLAPTPWLDGKHTIFGRVASGMDVIKRMGLVQTDPSSDKP
A9NNI6________________GGESIYGPRFEDEITRDLKHTGAGILSMANAGPNTNGSQFFISLAPTPWLDEKHTIFGRVCKGMDVVKRLGNVQTD-KNDRP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain