SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene152577

Length: 248 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene152577
GAGGTGGACAGTCTATCTATGGCACACCCTTCGAAGATGAACTCACTCGCGAACTCAAACACACTGGGGCAGGTGTTCTCTCCATGGCCAACTCAGGACCCAACACTAATGGTTCACAGTTCTTCATCTCCCTCGCTCCAACCCCCTGGCTCGATGGCAAACACACCATCTTTGGTCGTGTTGCCTCTGGCATGGATGTCATCAAGCGCATGGGCTTGGTCCAAACCGATCCCTCCTCTGACAAACCT

Ace file of the UniGene sp_v3.0_unigene152577 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Peptidyl-prolyl cis-trans isomerase n=1 Tax=Selaginella moellendorffii RepID=D8RE87_SELML	-	-	2.0e-33	85%
FL-Next	sp=Peptidyl-prolyl cis-trans isomerase; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	79%
Sma3	Peptidyl-prolyl cis-trans isomerase	-	-	0.0	-

Source	ECs	Term	Type	e value	Identity
Sma3	Peptidylprolyl isomerase.	EC:5.2.1.8	-	0.0	-

Source	Gene names
Sma3	43H1; AT3G63400; At2g21130; At2g29960; At2g36130; At3g44600; At3g44600/F14L2_150; At3g55920; At3g56070; At3g63400; At4g34870; At4g38740; At5g13120; B1331F11.9; CHLREDRAFT_132902; CHLREDRAFT_185571; CHLREDRAFT_196289; CHLREDRAFT_196565; CHLREDRAFT_30209; C

Source	GOs	Term	Type	Identity
Sma3	membrane fraction	GO:0005624	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	multivesicular body	GO:0005771	Cellular Component	-
Sma3	endoplasmic reticulum	GO:0005783	Cellular Component	-
Sma3	Golgi stack	GO:0005795	Cellular Component	-
Sma3	cytosol	GO:0005829	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	chloroplast thylakoid membrane	GO:0009535	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	thylakoid lumen	GO:0031977	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	chromatin binding	GO:0003682	Molecular Function	-
Sma3	peptidyl-prolyl cis-trans isomerase activity	GO:0003755	Molecular Function	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	peptide binding	GO:0042277	Molecular Function	-
Sma3	histone binding	GO:0042393	Molecular Function	-
Sma3	protein folding	GO:0006457	Biological Process	-
Sma3	RNA splicing	GO:0008380	Biological Process	-
Sma3	plant-type hypersensitive response	GO:0009626	Biological Process	-
Sma3	regulation of flower development	GO:0009909	Biological Process	-
Sma3	meristem structural organization	GO:0009933	Biological Process	-
Sma3	regulation of root meristem growth	GO:0010082	Biological Process	-
Sma3	leaf vascular tissue pattern formation	GO:0010305	Biological Process	-
Sma3	leaf formation	GO:0010338	Biological Process	-
Sma3	leaf shaping	GO:0010358	Biological Process	-
Sma3	regulation of histone methylation	GO:0031060	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-
Sma3	carpel development	GO:0048440	Biological Process	-
Sma3	stamen development	GO:0048443	Biological Process	-
Sma3	sepal formation	GO:0048453	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain	IPR000194	-	-
Sma3	Peptidyl-prolyl cis-trans isomerase, FKBP-type, domain	IPR001179	-	-
Sma3	Tetratricopeptide TPR-1	IPR001440	-	-
Sma3	WD40 repeat	IPR001680	-	-
Sma3	Cyclophilin-like peptidyl-prolyl cis-trans isomerase domain	IPR002130	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-
Sma3	Tetratricopeptide repeat-containing domain	IPR013026	-	-
Sma3	mRNA splicing factor SYF2	IPR013260	-	-
Sma3	WD40/YVTN repeat-like-containing domain	IPR015943	-	-
Sma3	WD40-repeat-containing domain	IPR017986	-	-
Sma3	Tetratricopeptide repeat	IPR019734	-	-
Sma3		IPR019782	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G36130.1	Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein chr2:15166863-15168259 FORWARD LENGTH=164	7.0e-40	75%
RefSeq	Arabidopsis thaliana	NP_181157.1	peptidyl-prolyl cis-trans isomerase-like 1 [Arabidopsis thaliana]	8.99999e-40	75%
RefSeq	Populus trichocarpa	XP_002322812.1	predicted protein [Populus trichocarpa]	5.0e-39	74%

Full-Lengther Next Prediction

Fln status: Putative C-terminus

Fln database: coniferopsida.fasta

Fln subject: A9NNI6

Fln msg: STOP codon was not found. Distance to subject end: 13 aas, your sequence is shorter than subject: 82 - 163

Fln protein: GGQSIYGTPFEDELTRELKHTGAGVLSMANSGPNTNGSQFFISLAPTPWLDGKHTIFGRVASGMDVIKRMGLVQTDPSSDKP

Protein Length: 83

Fln nts: GAGGTGGACAGTCTATCTATGGCACACCCTTCGAAGATGAACTCACTCGCGAACTCAAACACACTGGGGCAGGTGTTCTCTCCATGGCCAACTCAGGACCCAACACTAATGGTTCACAGTTCTTCATCTCCCTCGCTCCAACCCCCTGGCTCGATGGCAAACACACCATCTTTGGTCGTGTTGCCTCTGGCATGGATGTCATCAAGCGCATGGGCTTGGTCCAAACCGATCCCTCCTCTGACAAACCT

Fln Alignment:

HLKU4M004JCM2A___GGQSIYGTPFEDELTRELKHTGAGVLSMANSGPNTNGSQFFISLAPTPWLDGKHTIFGRVASGMDVIKRMGLVQTDPSSDKP
A9NNI6________________GGESIYGPRFEDEITRDLKHTGAGILSMANAGPNTNGSQFFISLAPTPWLDEKHTIFGRVCKGMDVVKRLGNVQTD-KNDRP

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain