UniGene Name: sp_v3.0_unigene151946
Length: 231 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene151946
T |
Ace file of the UniGene sp_v3.0_unigene151946
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Ras-related nuclear protein [Priapulus caudatus] | - | - | 2.0e-31 | 83% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 73% |
| Sma3 | Ras-related nuclear protein 3 | - | - | 5.447e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | At5g20010; At5g20020; At5g55080; At5g55190; CHLREDRAFT_128522; F28I16.160; F28I16.170; GSVIVT00014705001; GSVIVT00016839001; GSVIVT00032600001; GSVIVT00032601001; GSVIVT00034551001; MCO15.14; MCO15.3; MICPUCDRAFT_33456; MICPUN_82870; OSTLU_41856; OsI_0227 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | nuclear envelope | GO:0005635 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | GTPase activity | GO:0003924 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
| Sma3 | intracellular protein transport | GO:0006886 | Biological Process | 0.0 | - |
| Sma3 | nucleocytoplasmic transport | GO:0006913 | Biological Process | 0.0 | - |
| Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Small GTPase superfamily | IPR001806 | - | 0.0 | - |
| Sma3 | Ran GTPase | IPR002041 | - | 0.0 | - |
| Sma3 | Small GTP-binding protein domain | IPR005225 | - | 0.0 | - |
| Sma3 | IPR013753 | - | 0.0 | - | |
| Sma3 | IPR018210 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G20010.1 | RAN-1, RAN1, ATRAN1 RAS-related nuclear protein-1 chr5:6760364-6761747 FORWARD LENGTH=221 | 1.0e-33 | 73% |
| RefSeq | Arabidopsis thaliana | NP_200330.1 | GTP-binding nuclear protein Ran-3 [Arabidopsis thaliana] | 1.0e-33 | 73% |
| RefSeq | Populus trichocarpa | XP_002308648.1 | predicted protein [Populus trichocarpa] | 1.0e-33 | 73% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NR12
Fln msg: Distance to subject end: 67 aas, your sequence is shorter than subject: 76 - 220
Fln protein:
E
Protein Length:
77
Fln nts:
T
Fln Alignment:
HLKU4M004H6U0T___YPRTMCYSRMFDVTSRVTYKNVPNWHRDIVRVCENIPIVLTGNKIDIKDRRVKAKQITFHRKKNLQYYDIS
A9NR12________________YIHGQCAVIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEIS

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta