|
||||||
|
UniGene Name: sp_v3.0_unigene151717
Length: 227 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene151717
G |
|
Ace file of the UniGene sp_v3.0_unigene151717
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | WD-repeat protein, putative n=1 Tax=Ricinus communis RepID=B9SSV2_RICCO | - | - | 3.0e-28 | 77% |
| FL-Next | sp=Peptidyl-prolyl cis-trans isomerase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 58% |
| Sma3 | Peptidyl-prolyl cis-trans isomerase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidylprolyl isomerase. | EC:5.2.1.8 | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | 46C02.10; 56B23-g9; At2g15790; At2g21130; At2g36130; At3g44600; At3g44600/F14L2_150; At3g55920; At3g56070; At4g38740; At5g13120; B1331F11.9; CHLREDRAFT_132902; CHLREDRAFT_136386; CHLREDRAFT_196289; CHLREDRAFT_30209; CHLREDRAFT_30639; CYN18-2; CYN19-2; CYN |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
| Sma3 | thylakoid lumen | GO:0031977 | Cellular Component | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | peptidyl-prolyl cis-trans isomerase activity | GO:0003755 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | peptide binding | GO:0042277 | Molecular Function | 0.0 | - |
| Sma3 | histone binding | GO:0042393 | Molecular Function | 0.0 | - |
| Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
| Sma3 | regulation of flower development | GO:0009909 | Biological Process | 0.0 | - |
| Sma3 | meristem structural organization | GO:0009933 | Biological Process | 0.0 | - |
| Sma3 | vegetative phase change | GO:0010050 | Biological Process | 0.0 | - |
| Sma3 | regulation of root meristem growth | GO:0010082 | Biological Process | 0.0 | - |
| Sma3 | leaf vascular tissue pattern formation | GO:0010305 | Biological Process | 0.0 | - |
| Sma3 | leaf formation | GO:0010338 | Biological Process | 0.0 | - |
| Sma3 | leaf shaping | GO:0010358 | Biological Process | 0.0 | - |
| Sma3 | floral meristem determinacy | GO:0010582 | Biological Process | 0.0 | - |
| Sma3 | regulation of histone methylation | GO:0031060 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | carpel development | GO:0048440 | Biological Process | 0.0 | - |
| Sma3 | stamen development | GO:0048443 | Biological Process | 0.0 | - |
| Sma3 | sepal formation | GO:0048453 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
| Sma3 | Peptidyl-prolyl cis-trans isomerase, FKBP-type, domain | IPR001179 | - | 0.0 | - |
| Sma3 | Tetratricopeptide TPR-1 | IPR001440 | - | 0.0 | - |
| Sma3 | WD40 repeat | IPR001680 | - | 0.0 | - |
| Sma3 | Cyclophilin-like peptidyl-prolyl cis-trans isomerase domain | IPR002130 | - | 0.0 | - |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | Tetratricopeptide repeat-containing domain | IPR013026 | - | 0.0 | - |
| Sma3 | Tetratricopeptide TPR2 | IPR013105 | - | 0.0 | - |
| Sma3 | mRNA splicing factor SYF2 | IPR013260 | - | 0.0 | - |
| Sma3 | WD40/YVTN repeat-like-containing domain | IPR015943 | - | 0.0 | - |
| Sma3 | WD40-repeat-containing domain | IPR017986 | - | 0.0 | - |
| Sma3 | Tetratricopeptide repeat | IPR019734 | - | 0.0 | - |
| Sma3 | IPR019782 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G44600.1 | CYP71 cyclophilin71 chr3:16165368-16169201 REVERSE LENGTH=631 | 3.0e-34 | 74% |
| RefSeq | Arabidopsis thaliana | NP_190046.2 | peptidylprolyl isomerase domain and WD repeat-containing protein 1 [Arabidopsis thaliana] | 4.0e-34 | 74% |
| RefSeq | Populus trichocarpa | XP_002312902.1 | predicted protein [Populus trichocarpa] | 1.0e-33 | 74% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NNI6
Fln msg: STOP codon was not found. Distance to subject end: 4 aas, your sequence is shorter than subject: 75 - 163
Fln protein:
R
Protein Length:
76
Fln nts:
G
Fln Alignment:
HLKU4M004JV117___RNLRHDRPFTVSMANAGPNTNGSQFFITTVPTPWLDNKHTVFGRVTKGYEVIKKIEDLKCNKLDKPYDEVKIL
A9NNI6________________RDLKHTGAGILSMANAGPNTNGSQFFISLAPTPWLDEKHTIFGRVCKGMDVVKRLGNVQTDKNDRPIHDVKIL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
