UniGene Name: sp_v3.0_unigene150919
Length: 155 nt
![]() |
---|
>sp_v3.0_unigene150919
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Ras-like GTP-binding protein, putative n=2 Tax=Aspergillus RepID=B8NQY9_ASPFN | - | - | 3.0e-12 | 68% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 56% |
Sma3 | Rab8/RabE-family small GTPase | - | - | 2.087e-10 | - |
Source | Gene names |
---|---|
Sma3 | AT4g18800; At1g28550; At2g33870; At3g15060; At3g15060/K15M2_21; At3g53610; At4g18800; At5g45750; At5g59840; At5g60860; At5g60860/mae1_110; BRAB-1; Dc-Rab8; ER43; F28A21.210; F4P12_310; GSVIVT00000602001; GSVIVT00003022001; GSVIVT00018533001; GSVIVT0001868 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
Sma3 | transcription factor binding | GO:0008134 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | small GTPase mediated signal transduction | GO:0007264 | Biological Process | 0.0 | - |
Sma3 | protein transport | GO:0015031 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Small GTPase superfamily | IPR001806 | - | 0.0 | - |
Sma3 | RNA polymerase sigma factor 54, interaction | IPR002078 | - | 0.0 | - |
Sma3 | Small GTPase superfamily, Rab type | IPR003579 | - | 0.0 | - |
Sma3 | Small GTP-binding protein domain | IPR005225 | - | 0.0 | - |
Sma3 | IPR013753 | - | 0.0 | - | |
Sma3 | IPR015595 | - | 0.0 | - | |
Sma3 | DNA-directed DNA polymerase, family A, conserved site | IPR019760 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G18800.1 | ATHSGBP, ATRAB11B, ATRABA1D, RABA1d RAB GTPase homolog A1D chr4:10320156-10321339 REVERSE LENGTH=214 | 8.0e-17 | 64% |
RefSeq | Arabidopsis thaliana | NP_193615.1 | RAB GTPase homolog A1D [Arabidopsis thaliana] | 1.0e-16 | 64% |
RefSeq | Populus trichocarpa | XP_002305729.1 | predicted protein [Populus trichocarpa] | 1.0e-16 | 64% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P1Y8
Fln msg: Distance to subject end: 94 aas, your sequence is shorter than subject: 51 - 203
Fln protein:
V
Protein Length:
52
Fln nts:
G
Fln Alignment:
HLKU4M004I8KOD___VNCQIWDTAGQERFSCISKEYYRGANGCLLVYDVTDHSSFLKVEHWYSEL
A9P1Y8________________IKFQIWDTAGQERFKTVTSSYYRGAHGIIIVYDITDMDSFDHVKHWLTEI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain