UniGene Name: sp_v3.0_unigene149501
Length: 193 nt
![]() |
---|
>sp_v3.0_unigene149501
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Xyloglucan galactosyltransferase KATAMARI1 n=4 Tax=Arabidopsis RepID=KATAM_ARATH | - | - | 9.0e-16 | 67% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 61% |
Sma3 | Putative exostosin family protein | - | - | 3.816e-12 | - |
Source | Gene names |
---|---|
Sma3 | AT2G20370; At2g20370; At2g29040; At2g32740; At4g13990; F11A3.8; GSVIVT00024302001; GSVIVT00028497001; GSVIVT00033532001; KAM1; LOC_Os03g05060; LOC_Os03g05070; LOC_Os03g05110; LOC_Os10g32080; LOC_Os10g32160; LOC_Os10g32170; MUR3; OJ1172F09.2; OJ1172F09.3; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | integral to Golgi membrane | GO:0030173 | Cellular Component | 0.0 | - |
Sma3 | peptidase activity | GO:0008233 | Molecular Function | 0.0 | - |
Sma3 | transferase activity, transferring glycosyl groups | GO:0016757 | Molecular Function | 0.0 | - |
Sma3 | signal peptide processing | GO:0006465 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | unidimensional cell growth | GO:0009826 | Biological Process | 0.0 | - |
Sma3 | salicylic acid mediated signaling pathway | GO:0009863 | Biological Process | 0.0 | - |
Sma3 | xyloglucan biosynthetic process | GO:0009969 | Biological Process | 0.0 | - |
Sma3 | endomembrane system organization | GO:0010256 | Biological Process | 0.0 | - |
Sma3 | fucose biosynthetic process | GO:0042353 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S26B, eukaryotic signal peptidase | IPR001733 | - | 0.0 | - |
Sma3 | Exostosin-like | IPR004263 | - | 0.0 | - |
Sma3 | Peptidase S24/S26A/S26B | IPR019759 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G20370.1 | KAM1, MUR3 Exostosin family protein chr2:8792355-8794214 FORWARD LENGTH=619 | 5.0e-21 | 67% |
RefSeq | Arabidopsis thaliana | NP_179627.2 | xyloglucan galactosyltransferase KATAMARI1 [Arabidopsis thaliana] | 6.0e-21 | 67% |
RefSeq | Populus trichocarpa | XP_002301846.1 | glycosyltransferase, CAZy family GT47 [Populus trichocarpa] | 3.0e-20 | 64% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NT31
Fln msg: Distance to subject end: 62 aas, your sequence is shorter than subject: 64 - 155
Fln protein:
K
Protein Length:
65
Fln nts:
C
Fln Alignment:
HIF1XHV02D35BP___RRSIFDSMLAGCIPVFFTEHSGYTQYKWHLPQNRSSYSVYIPEE
A9NT31________________RRSTFDALIAGCIPVFFRRDSAYEQYTWHLPSDPETYSVFIAEE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain