|
||||||
|
UniGene Name: sp_v3.0_unigene149244
Length: 198 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene149244
C |
|
Ace file of the UniGene sp_v3.0_unigene149244
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9R995_RICCO | - | - | 7.0e-26 | 87% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
| Sma3 | ATP binding protein, putative | - | - | 1.554e-24 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G26850; AT1G31850; AT4G18030; AT4G19120; AT4g00750; AT4g10440; AT4g18030; At1g04430; At1g04430/F19P19.11; At1g26850; At1g31850; At1g33170; At2g39750; At2g43143; At2g43200; At2g45750; At3g10200; At4g00740; At4g00740/F15P23.2; At4g00750; At4g10440; At4g1 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | FMN binding | GO:0010181 | Molecular Function | 0.0 | - |
| Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | iron-sulfur cluster binding | GO:0051536 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Cystathionine beta-synthase, core | IPR000644 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 10 | IPR001000 | - | 0.0 | - |
| Sma3 | Flavodoxin | IPR001094 | - | 0.0 | - |
| Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Ankyrin repeat | IPR002110 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF21 | IPR002550 | - | 0.0 | - |
| Sma3 | Putative S-adenosyl-L-methionine-dependent methyltransferase | IPR004159 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | Radical SAM | IPR007197 | - | 0.0 | - |
| Sma3 | Cytokine-induced anti-apoptosis inhibitor 1 | IPR007785 | - | 0.0 | - |
| Sma3 | Flavodoxin/nitric oxide synthase | IPR008254 | - | 0.0 | - |
| Sma3 | tRNA wybutosine-synthesis | IPR013917 | - | 0.0 | - |
| Sma3 | IPR017909 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G26850.1 | S-adenosyl-L-methionine-dependent methyltransferases superfamily protein chr1:9301146-9303432 REVERSE LENGTH=616 | 2.0e-30 | 79% |
| RefSeq | Arabidopsis thaliana | NP_564265.1 | putative methyltransferase PMT2 [Arabidopsis thaliana] | 3.0e-30 | 79% |
| RefSeq | Populus trichocarpa | XP_002317981.1 | predicted protein [Populus trichocarpa] | 6.0e-33 | 87% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLQ2
Fln msg: Distance to subject end: 46 aas, your sequence is shorter than subject: 65 - 635
Fln protein:
L
Protein Length:
66
Fln nts:
C
Fln Alignment:
HIF1XHV02EWMI3___LIGIYHDWCEAFSTYPRTYDLIHANGVFNMYQDRCNTEDILLEMDRILRPEGVAVILRDNVDVL
B8LLQ2________________LIGTYMDWCEAFSTYPRTYDLIHANGIFSMYQDRCDMVDILLEMDRILRPEG-AVIIRDSVDVL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
