|
||||||
|
UniGene Name: sp_v3.0_unigene148358
Length: 226 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene148358
A |
|
Ace file of the UniGene sp_v3.0_unigene148358 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Polyprotein (Fragment) n=1 Tax=Ananas comosus RepID=B4YF15_ANACO | - | - | 5.0e-22 | 59% |
| FL-Next | tr=Putative retrotransposon protein; Phyllostachys edulis. | - | - | 0.0 | 60% |
| Sma3 | Retrotransposon protein, putative, unclassified | - | - | 4.839e-13 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g14640; F23H6.1; H0321H01.8; H0502G05.7; LOC_Os03g30360; LOC_Os03g47870; LOC_Os10g28310; LOC_Os10g40400; LOC_Os10g40890; LOC_Os10g42880; LOC_Os11g08610; LOC_Os11g26820; LOC_Os11g31050; LOC_Os11g45000; LOC_Os11g45200; OSJNBa0004L19.22; OSJNBa0010C11.17; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: D3IVG4
Fln msg: Distance to subject end: 179 aas, your sequence is shorter than subject: 74 - 335
Fln protein:
L
Protein Length:
75
Fln nts:
A
Fln Alignment:
HLKU4M001BEFX9___LFNHIGTYLNMSSAYHPQTDRQTEVVNKCFEAYLRCYATEKQNEWAQWLHLAEWWYNYTYHMSTKMMPFQALYG
D3IVG4________________IFKMLKVTLRLSTAYHPQTDRQTERVNQCLEAYLRSMTFQEPREWMNWLTLAEWWYNTTYHTSLKVTPFQALYG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
