SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene143761

Length: 512 nt

UniGene Fasta

>sp_v3.0_unigene143761
GACTATGACCGTCAAAAACCAGTGCTCATACACAGTTTGGGCGGCTGGCAGTCCGGGCGGCGGTAAGCAACTGGGGCAGGGTGAGACATGGAGTTTTGATGTTCCAGCGGGAACAACAGGAGGCAGAATCTGGGGGCGTACCGGTTGCTCCTTCGACGCTGGCAGTGGTACAGGTAGCTGTACCACTGGTGACTGTGGTGGGTTGCTCAGTTGTCAAGGCTATGGAAGCGTCCCTGCAACGCTTTTTGAATATGGTCTGAATAAGTACCAGAATCAAGACTTCTACGATATCTCTCTTGTCGATGGCTTCAATATCCCTCTCTCTGTAACTCCCTCAGACTCTTCGTGCAAAGTAATAGGTTGCACCACCGACATAAATGCGGTGTGCCCTTCAGAACTGAAAGTGACCGATGGATGCAAGAGTGCTTGTGCGGAGTTCAATACCCCTCAATACTGCTGCACTGGAGACTATGCAAACAACTGCTCTCCCACGAACTATTCCGAGTTACATT

Ace file of the UniGene sp_v3.0_unigene143761

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	Identity
AutoFact	Thaumatin-like protein n=1 Tax=Pinus taeda RepID=A5HIY3_PINTA	-	-	74%
FL-Next	tr=Thaumatin-like protein; Pinus taeda (Loblolly pine).	-	-	97%
Sma3	Thaumatin-like protein	-	-	-

Source	Gene names
Sma3	5A1A.16; AP24; At1g19320; At1g75030; At1g75040; At1g75050; At4g11650; Cry j 3.1; Cry j 3.2; Cry j 3.3; Cry j 3.4; Cry j 3.5; Cry j 3.6; Cry j 3.7; Cry j 3.8; F9E10.10; F9E10.11; F9E10.12; GSVIVT00001102001; GSVIVT00001103001; GSVIVT00001104001; GSVIVT0000

Source	GOs	Term	Type	Identity
Sma3	extracellular region	GO:0005576	Cellular Component	-
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	cytoplasmic vesicle	GO:0031410	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	serine-type endopeptidase inhibitor activity	GO:0004867	Molecular Function	-
Sma3	receptor activity	GO:0004872	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	xenobiotic metabolic process	GO:0006805	Biological Process	-
Sma3	response to stress	GO:0006950	Biological Process	-
Sma3	defense response	GO:0006952	Biological Process	-
Sma3	response to biotic stimulus	GO:0009607	Biological Process	-
Sma3	systemic acquired resistance	GO:0009627	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-
Sma3	response to UV-B	GO:0010224	Biological Process	-
Sma3	regulation of anthocyanin biosynthetic process	GO:0031540	Biological Process	-
Sma3	defense response to fungus	GO:0050832	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Aminotransferase, class-II, pyridoxal-phosphate binding site	IPR001917	-	-
Sma3	Thaumatin, pathogenesis-related	IPR001938	-	-
Sma3	Carbohydrate/puine kinase, PfkB, conserved site	IPR002173	-	-
Sma3	Serine/threonine- / dual-specificity protein kinase, catalytic domain	IPR002290	-	-
Sma3	Immunoglobulin/major histocompatibility complex, conserved site	IPR003006	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Thaumatin, conserved site	IPR017949	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT4G11650.1	ATOSM34, OSM34 osmotin 34 chr4:7025127-7026113 REVERSE LENGTH=244	7.00005e-41	53%
RefSeq	Arabidopsis thaliana	NP_192902.1	osmotin-like protein OSM34 [Arabidopsis thaliana]	8.99998e-41	53%
RefSeq	Populus trichocarpa	XP_002325077.1	predicted protein [Populus trichocarpa]	8.0e-40	50%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A5HIY3

Fln msg: Distance to subject end: 33 aas, your sequence is shorter than subject: 170 - 234

Fln protein: TMTVKNQCSYTVWAAGSPGGGKQLGQGETWSFDVPAGTTGGRIWGRTGCSFDAGSGTGSCTTGDCGGLLSCQGYGSVPATLFEYGLNKYQNQDFYDISLVDGFNIPLSVTPSDSSCKVIGCTTDINAVCPSELKVTDGCKSACAEFNTPQYCCTGDYANNCSPTNYSELH

Protein Length: 171

Fln nts: GACTATGACCGTCAAAAACCAGTGCTCATACACAGTTTGGGCGGCTGGCAGTCCGGGCGGCGGTAAGCAACTGGGGCAGGGTGAGACATGGAGTTTTGATGTTCCAGCGGGAACAACAGGAGGCAGAATCTGGGGGCGTACCGGTTGCTCCTTCGACGCTGGCAGTGGTACAGGTAGCTGTACCACTGGTGACTGTGGTGGGTTGCTCAGTTGTCAAGGCTATGGAAGCGTCCCTGCAACGCTTTTTGAATATGGTCTGAATAAGTACCAGAATCAAGACTTCTACGATATCTCTCTTGTCGATGGCTTCAATATCCCTCTCTCTGTAACTCCCTCAGACTCTTCGTGCAAAGTAATAGGTTGCACCACCGACATAAATGCGGTGTGCCCTTCAGAACTGAAAGTGACCGATGGATGCAAGAGTGCTTGTGCGGAGTTCAATACCCCTCAATACTGCTGCACTGGAGACTATGCAAACAACTGCTCTCCCACGAACTATTCCGAGTTACATT

Fln Alignment:

AllPine_a_rep_c111954___TMTVKNQCSYTVWAAXXXXXXXXXXXXETWSFDVPAXXXXXXXXXXXXCSFDAXXXXXXXXXXXXXXLLSCQGYGSVPATLFEYGLNKYQNQDFYDISLVDGFNIPLSVTPSDSSCKVIGCTTDINAVCPSELKVTDGCKSACAEFNTPQYCCTGDYANNCSPTNYSE
A5HIY3________________TMTVKNQCSYTVWAAGSPGGGKQLGQGETWSFDVPAGTTGGRIWGRTGCSFDAGSGTGSCTTGDCGGLLNCQGYGSVPATLFEYGLNKYQNLDFYDISLVDGFNIPLSVTPSDSSCKVIGCTTDINAVCPAELKVTDGCKSACAEFNTPQYCCTGDYLNNCSPTNYSQ

SNPs (tot: 10)

Position	A %	C %	G %	T %	Probability
142	33	66			0.997452
143	33		66		0.997452
210	33		66		1.0
241	33		66		0.997452
286		57		42	1.0
324	14			85	0.993533
325		85		14	0.993533
464		66		33	0.997467
467		33		66	0.997459
497		33	66		0.997452

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain