|
||||||
|
UniGene Name: sp_v3.0_unigene142817
Length: 233 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene142817
G |
|
Ace file of the UniGene sp_v3.0_unigene142817
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Monodehydroascorbate reductase n=1 Tax=Lilium longiflorum RepID=D5LMH3_LILLO | - | - | 1.0e-23 | 78% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 91% |
| Sma3 | Monodehydroascorbate reductase | - | - | 1.12104e-44 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Monodehydroascorbate reductase (NADH). | EC:1.6.5.4 | - | 9.94e-27 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ascorbate and aldarate metabolism | 00053 | 9.94e-27 | % | |
| Sma3 | Metabolic pathways | 01100 | 9.94e-27 | % |
| Source | Gene names |
|---|---|
| Sma3 | AFRR; AT3G52880; At3g09940; At3g52880; At5g03630; BO-MDAR 2; F17C15_50; F8J2_50; GSVIVT00021644001; MDAR; MDHAR1; Mdhar1; Mdhar2; Mdhar3; OJ1150_A11.25; OJ1155_H10.27; Os08g0557600; Os09g0567300; OsI_30244; OsI_32437; OsJ_28260; OsJ_30387; PHYPADRAFT_1695 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | peroxisomal matrix | GO:0005782 | Cellular Component | 0.0 | - |
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | monodehydroascorbate reductase (NADH) activity | GO:0016656 | Molecular Function | 0.0 | - |
| Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, NAD-binding domain | IPR001327 | - | 0.0 | - |
| Sma3 | FAD-dependent pyridine nucleotide-disulphide oxidoreductase | IPR013027 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G03630.1 | ATMDAR2 Pyridine nucleotide-disulphide oxidoreductase family protein chr5:922378-924616 REVERSE LENGTH=435 | 4.0e-27 | 70% |
| RefSeq | Arabidopsis thaliana | NP_568125.1 | monodehydroascorbate reductase (NADH) [Arabidopsis thaliana] | 5.0e-27 | 70% |
| RefSeq | Populus trichocarpa | XP_002326252.1 | predicted protein [Populus trichocarpa] | 1.0e-29 | 77% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PQT8
Fln msg: Distance to subject end: 284 aas, your sequence is shorter than subject: 77 - 434
Fln protein:
G
Protein Length:
78
Fln nts:
G
Fln Alignment:
AllPine_a_rep_c108703___GGERQLPEWYTEKGIELILSTEVVKAEIATKTLTSAEGTTFKYGTLIIATGSTVINLSDFGTQGADAKGI
C0PQT8________________GGERQLPEWYSEKGIELILSTEVVKAEIASKTLTTAEGTTFKYDTLIIATGSTVIKLSDFGVQGADAKGI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
