|
||||||
|
UniGene Name: sp_v3.0_unigene142174
Length: 230 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene142174
A |
|
Ace file of the UniGene sp_v3.0_unigene142174
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Eukaryotic initiation factor 4A (ATP-dependent RNA helicase eIF4A) n=1 Tax=Chlorella variabilis RepID=E1ZM95_9CHLO | - | - | 1.0e-15 | 89% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
| Sma3 | Eukaryotic initiation factor 4A-like protein | - | - | 5.506e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Hydrolases, Acting on acid anhydrides, In phosphorous-containing anhydrides. | EC:3.6.1.- | - | 1.008e-09 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Purine metabolism | 00230 | 1.008e-09 | % | |
| Sma3 | Lipopolysaccharide biosynthesis | 00540 | 1.008e-09 | % | |
| Sma3 | Folate biosynthesis | 00790 | 1.008e-09 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.008e-09 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT1G54270; AT3G13920; At1g54270; At1g72730; At3g13920; At3g19760; B1131G07.20; CHLREDRAFT_188942; EIF4A; F20D21.9; F20D21_52; F28P22.8; GSVIVT00016530001; GSVIVT00032180001; GSVIVT00034135001; GSVIVT00037338001; LOC_Os01g45190; LOC_Os02g05330; LOC_Os02g12 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | translation initiation factor activity | GO:0003743 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
| Sma3 | rRNA processing | GO:0006364 | Biological Process | 0.0 | - |
| Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | RNA helicase, ATP-dependent, DEAD-box, conserved site | IPR000629 | - | 0.0 | - |
| Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
| Sma3 | WD40 repeat | IPR001680 | - | 0.0 | - |
| Sma3 | DNA/RNA helicase, DEAD/DEAH box type, N-terminal | IPR011545 | - | 0.0 | - |
| Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
| Sma3 | RNA helicase, DEAD-box type, Q motif | IPR014014 | - | 0.0 | - |
| Sma3 | IPR014021 | - | 0.0 | - | |
| Sma3 | WD40/YVTN repeat-like-containing domain | IPR015943 | - | 0.0 | - |
| Sma3 | WD40-repeat-containing domain | IPR017986 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Sma3 | IPR019782 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G54270.1 | EIF4A-2 eif4a-2 chr1:20260495-20262018 FORWARD LENGTH=412 | 3.0e-20 | 84% |
| RefSeq | Arabidopsis thaliana | NP_001185220.1 | translation initiation factor 4A-2 [Arabidopsis thaliana] | 3.0e-20 | 84% |
| RefSeq | Populus trichocarpa | XP_002337398.1 | predicted protein, partial [Populus trichocarpa] | 4.0e-20 | 84% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LMF4
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 201 aas, atg_distance in limit (1-15): atg_distance = 10, W2: There is no M at the beginning, your sequence is shorter than subject: 72 - 286
Fln protein:
C
Protein Length:
73
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c105986___GLDVVVGTPGRVYDMLRRRALRPDSIKMFVLDEADEMLSRGFKDQV
B8LMF4________________GVHVVVGTPGRVYDMLRRRALRPDSIKMFVLDEADEMLSRGFKDQI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
