UniGene Name: sp_v3.0_unigene140658
Length: 236 nt
UniGene Fasta |
---|
>sp_v3.0_unigene140658
C |
Ace file of the UniGene sp_v3.0_unigene140658 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Homeodomain leucine-zipper 1 n=1 Tax=Nicotiana benthamiana RepID=C6FFS4_NICBE | - | - | 2.0e-19 | 65% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 63% |
Sma3 | Homeobox protein, putative | - | - | 2.174e-14 | - |
Source | Gene names |
---|---|
Sma3 | 25.t00036; 31.t00070; 40.t00018; 57h21.15; ATHB-17; ATHB-2; ATHB-4; At2g01430; At2g22800; At2g44910; At3g60390; At4g16780; At4g17460; At4g37790; At5g06710; At5g47370; CPHB-3; Crhb10; Crhb2; Crhb3; Crhb9; EcHB1; F2I9.5; FCAALL.101; FCAALL.65; GSVIVT0000373 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | transcription activator activity | GO:0016563 | Molecular Function | 0.0 | - |
Sma3 | transcription repressor activity | GO:0016564 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | shade avoidance | GO:0009641 | Biological Process | 0.0 | - |
Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
Sma3 | response to cytokinin stimulus | GO:0009735 | Biological Process | 0.0 | - |
Sma3 | unidimensional cell growth | GO:0009826 | Biological Process | 0.0 | - |
Sma3 | response to far red light | GO:0010218 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Helix-turn-helix motif | IPR000047 | - | 0.0 | - |
Sma3 | Major intrinsic protein | IPR000425 | - | 0.0 | - |
Sma3 | Homeodomain | IPR001356 | - | 0.0 | - |
Sma3 | Leucine zipper, homeobox-associated | IPR003106 | - | 0.0 | - |
Sma3 | HD-ZIP protein, N-terminal | IPR006712 | - | 0.0 | - |
Sma3 | IPR012287 | - | 0.0 | - | |
Sma3 | Homeobox, conserved site | IPR017970 | - | 0.0 | - |
Sma3 | Chaperonin Cpn60, conserved site | IPR018370 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G37790.1 | HAT22 Homeobox-leucine zipper protein family chr4:17768241-17769272 FORWARD LENGTH=278 | 1.0e-24 | 65% |
RefSeq | Arabidopsis thaliana | NP_195493.1 | homeobox-leucine zipper protein HAT22 [Arabidopsis thaliana] | 2.0e-24 | 65% |
RefSeq | Populus trichocarpa | XP_002310877.1 | predicted protein [Populus trichocarpa] | 6.0e-25 | 65% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NKN4
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 35 aas, your sequence is shorter than subject: 78 - 309
Fln protein:
S
Protein Length:
79
Fln nts:
C
Fln Alignment:
AllPine_a_rep_c101645___LSLKLNLHPRQVEVWFQNRRARTKLKQIEMDYEVMKKYNEALTDENRKLHMELEKLKAFKMSSP--PLRPASTLTM
A9NKN4________________LAKRLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCESLTDENRRLQKELQELRALKLASPLYMQMPAATLTM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain