UniGene Name: sp_v3.0_unigene137949
Length: 228 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene137949
A |
Ace file of the UniGene sp_v3.0_unigene137949
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | cell-autonomous heat shock cognate protein 70 [Cucurbita maxima] | - | - | 6.0e-34 | 98% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 95% |
| Sma3 | Heat shock protein 70 | - | - | 4.499e-36 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g37910; At1g16030; At1g56410; At3g09440; At3g12580; At4g37910; At5g02490; At5g02500; At5g28540; At5g42020; BIP; BIP1; BIP2; BIP3; BIP4; BIP5; BIPE2; BIPE3; BLP4; BiP; BiPD; Bip; CHLREDRAFT_133650; CHLREDRAFT_133859; CHLREDRAFT_185673; EMB21; F11F8; F13 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum lumen | GO:0005788 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | nucleomorph | GO:0033009 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, uncoupled | GO:0042624 | Molecular Function | 0.0 | - |
| Sma3 | unfolded protein binding | GO:0051082 | Molecular Function | 0.0 | - |
| Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
| Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
| Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Heat shock protein Hsp70 | IPR001023 | - | 0.0 | - |
| Sma3 | Tetratricopeptide TPR-1 | IPR001440 | - | 0.0 | - |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | Chaperone DnaK | IPR012725 | - | 0.0 | - |
| Sma3 | Tetratricopeptide repeat-containing domain | IPR013026 | - | 0.0 | - |
| Sma3 | Heat shock protein 70 | IPR013126 | - | 0.0 | - |
| Sma3 | Heat shock protein 70, conserved site | IPR018181 | - | 0.0 | - |
| Sma3 | Tetratricopeptide repeat | IPR019734 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G16030.1 | Hsp70b heat shock protein 70B chr1:5502386-5504326 REVERSE LENGTH=646 | 8.00001e-41 | 93% |
| RefSeq | Arabidopsis thaliana | NP_173055.1 | heat shock protein 70B [Arabidopsis thaliana] | 9.99995e-41 | 93% |
| RefSeq | Populus trichocarpa | XP_002316294.1 | predicted protein [Populus trichocarpa] | 8.00001e-41 | 94% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NXU2
Fln msg: Distance to subject end: 369 aas, your sequence is shorter than subject: 75 - 651
Fln protein:
M
Protein Length:
76
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c96286___TFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVNHFVQEFKRKHKKDISGNARALRRLRTSCERAKRTLSS
A9NXU2________________TFDVSILTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKHKKDISGNARALRRLRTACERAKRTLSS

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta