SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene137909

Length: 264 nt

UniGene Fasta

>sp_v3.0_unigene137909
CACCATGATTGTGTGCCTGCAATTCTGCACAGGGATGTCAAATGCAATAACATACTTCTGGATGCAAGGTTTGAGCCATATTTAGCCGATTTCGGCCTTGCCAAGCTGATGACTGCTTCTGATTTTCATCTTGCGATGTCCAGGGTTGCTGGTTCATATGGCTACATTGCTCCTGAGTATGGCTACACAATGAACATTACAGAGAAGAGTGATGTATACAGCTATGGAATTGTTCTCCTTGAGATTTTGACTGGCAGAGACATT

Ace file of the UniGene sp_v3.0_unigene137909

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Leucine-rich repeat transmembrane protein kinase n=1 Tax=Glycine max RepID=C6ZRZ9_SOYBN	-	-	1.0e-37	86%
FL-Next	tr=Receptor protein kinase; Pinus sylvestris (Scots pine).	-	-	0.0	70%
Sma3	Leucine-rich repeat receptor-like protein kinase	-	-	5.855e-24	-

Source	ECs	Term	Type	e value	Identity
Sma3	2-alkenal reductase.	EC:1.3.1.74	-	4.523e-23	-
Sma3	Mitogen-activated protein kinase kinase kinase.	EC:2.7.11.25	-	1.348e-18	-
Sma3		EC:2.7.11.3-	-	9.187e-07	-

Source	Gene names
Sma3	AT1G08590; AT1G34110; AT1G75820; AT2G33170; AT3G49670; AT4G20270; AT4G28490; AT4G28650; AT4g20270; AT5G25930; AT5G48940; AT5G61480; AT5G62230; AT5G63930; AT5G65700; AT5G65710; At1g08590; At1g17230; At1g75820; At2g33170; At3g24240; At3g49670; At4g20270; At

Source	GOs	Term	Type	Identity
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	protein tyrosine kinase activity	GO:0004713	Molecular Function	-
Sma3	receptor activity	GO:0004872	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	identical protein binding	GO:0042802	Molecular Function	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	epidermis development	GO:0008544	Biological Process	-
Sma3	embryo sac development	GO:0009553	Biological Process	-
Sma3	megasporogenesis	GO:0009554	Biological Process	-
Sma3	microsporogenesis	GO:0009556	Biological Process	-
Sma3	embryo development	GO:0009790	Biological Process	-
Sma3	regulation of meristem structural organization	GO:0009934	Biological Process	-
Sma3	regulation of meristem growth	GO:0010075	Biological Process	-
Sma3	stomatal complex morphogenesis	GO:0010103	Biological Process	-
Sma3	microsporocyte differentiation	GO:0010480	Biological Process	-
Sma3	cell differentiation	GO:0030154	Biological Process	-
Sma3	interspecies interaction between organisms	GO:0044419	Biological Process	-
Sma3	protein autophosphorylation	GO:0046777	Biological Process	-
Sma3	gametophyte development	GO:0048229	Biological Process	-
Sma3	floral organ development	GO:0048437	Biological Process	-
Sma3	ovule development	GO:0048481	Biological Process	-
Sma3	tapetal layer development	GO:0048658	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Intradiol ring-cleavage dioxygenase, C-terminal	IPR000627	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Enolpyruvate transferase domain	IPR001986	-	-
Sma3	Short-chain dehydrogenase/reductase SDR	IPR002198	-	-
Sma3	Glucose/ribitol dehydrogenase	IPR002347	-	-
Sma3	Leucine-rich repeat, typical subtype	IPR003591	-	-
Sma3	Aminotransferases, class-I, pyridoxal-phosphate-binding site	IPR004838	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	Carbamoyl-phosphate synthetase, large subunit, ATP-binding	IPR005479	-	-
Sma3	Tyrosine-protein kinase, active site	IPR008266	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Leucine-rich repeat-containing N-terminal, type 2	IPR013210	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	ABC transporter, conserved site	IPR017871	-	-
Sma3	HTH domain AraC-type, conserved site	IPR018062	-	-
Sma3	Aldo/keto reductase, conserved site	IPR018170	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G34110.1	Leucine-rich receptor-like protein kinase family protein chr1:12417331-12421246 REVERSE LENGTH=1072	8.96831e-44	85%
RefSeq	Arabidopsis thaliana	NP_174673.3	leucine-rich receptor-like protein kinase [Arabidopsis thaliana]	9.94922e-44	85%
RefSeq	Populus trichocarpa	XP_002304699.1	predicted protein [Populus trichocarpa]	1.0e-37	70%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: Q9FEU2

Fln msg: Distance to subject end: 143 aas, your sequence is shorter than subject: 88 - 1145

Fln protein: HHDCVPAILHRDVKCNNILLDARFEPYLADFGLAKLMTASDFHLAMSRVAGSYGYIAPEYGYTMNITEKSDVYSYGIVLLEILTGRDI

Protein Length: 89

Fln nts: CACCATGATTGTGTGCCTGCAATTCTGCACAGGGATGTCAAATGCAATAACATACTTCTGGATGCAAGGTTTGAGCCATATTTAGCCGATTTCGGCCTTGCCAAGCTGATGACTGCTTCTGATTTTCATCTTGCGATGTCCAGGGTTGCTGGTTCATATGGCTACATTGCTCCTGAGTATGGCTACACAATGAACATTACAGAGAAGAGTGATGTATACAGCTATGGAATTGTTCTCCTTGAGATTTTGACTGGCAGAGACATT

Fln Alignment:

AllPine_a_rep_c96209___HHDCVPAILHRDVKCNNILLDARFEPYLADFGLAKLMTASDFHLAMSRVAGSYGYIAPEYGYTMNITEKSDVYSYGIVLLEILTGR
Q9FEU2________________HHDCRPPILHRDVKANNILLGSQYEPYLADFGLAKLVDSADFNRSSTTVAGSYGYIAPEYGYTMKITQKIDVYSFGVVLLEVVTGK

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain