UniGene Name: sp_v3.0_unigene137903
Length: 202 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene137903
C |
Ace file of the UniGene sp_v3.0_unigene137903
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | CBL-interacting protein kinase-like protein (Fragment) n=42 Tax=Picea sitchensis RepID=E0ZAQ0_PICSI | - | - | 1.0e-16 | 94% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 87% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Non-specific serine/threonine protein kinase. | EC:2.7.11.1 | - | 4.66e-06 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g26980; At5g21326; CIPK26; CIPK3; CIPK32; CIPK33; CIPK4; GSVIVT00017348001; LOC_Os11g03970; LOC_Os12g03810; Os11g0134300; Os12g0132200; OsI_34988; OsI_37378; OsJ_32852; OsJ_35128; PHYPADRAFT_70892; PKS12; PKS26; POPTRDRAFT_650368; POPTRDRAFT_672762; RC |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
| Sma3 | response to abiotic stimulus | GO:0009628 | Biological Process | 0.0 | - |
| Sma3 | response to cytokinin stimulus | GO:0009735 | Biological Process | 0.0 | - |
| Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | NAF domain | IPR004041 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | NAF/FISL domain | IPR018451 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G26980.4 | CIPK3 CBL-interacting protein kinase 3 chr2:11515234-11518426 REVERSE LENGTH=451 | 2.0e-11 | 69% |
| RefSeq | Arabidopsis thaliana | NP_850093.1 | CBL-interacting serine/threonine-protein kinase 3 [Arabidopsis thaliana] | 2.0e-11 | 69% |
| RefSeq | Populus trichocarpa | XP_002330980.1 | predicted protein [Populus trichocarpa] | 5.0e-11 | 75% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQ83
Fln msg: Separated hits, possible frame ERROR between 138 and 141, Distance to subject end: 90 aas, your sequence is shorter than subject: 67 - 387
Fln protein:
R
Protein Length:
68
Fln nts:
C
Fln Alignment:
AllPine_a_rep_c96194___SVFNDSEDHLVTEKKETQPVLMNAFELISTSQGLNLGNLxEMDMGLVKRETRFTSKHP
B8LQ83________________AVFNDSEEHLVTEKKETEPELMNAFELISMSQGLNLGNLxEMDMGMVKRETRFASKRP

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta