|
||||||
|
UniGene Name: sp_v3.0_unigene137599
Length: 220 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene137599
G |
|
Ace file of the UniGene sp_v3.0_unigene137599 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | [O] COG0464 ATPases of the AAA+ class | - | - | 2.0e-30 | 80% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 48% |
| Sma3 | Cell division cycle protein 48 | - | - | 7.065e-14 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Microtubule-severing ATPase. | EC:3.6.4.3 | - | 8.213e-12 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT3G09840; At1g03000; At1g53750; At3g09840; At3g53230; At5g03340; CAFP; CDC48; CDC48A; CDC48D; CDC48E; CHLREDRAFT_113394; CHLREDRAFT_134171; CHLREDRAFT_38371; F10O3.18; F12E4_70; F22G10.2; GSVIVT00016023001; GSVIVT00016352001; GSVIVT00023232001; GSVIVT000 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | cytoskeleton | GO:0005856 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | flagellum | GO:0019861 | Cellular Component | 0.0 | - |
| Sma3 | protein complex | GO:0043234 | Cellular Component | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, uncoupled | GO:0042624 | Molecular Function | 0.0 | - |
| Sma3 | fatty acid beta-oxidation | GO:0006635 | Biological Process | 0.0 | - |
| Sma3 | cell cycle | GO:0007049 | Biological Process | 0.0 | - |
| Sma3 | protein transport | GO:0015031 | Biological Process | 0.0 | - |
| Sma3 | protein import into peroxisome matrix | GO:0016558 | Biological Process | 0.0 | - |
| Sma3 | protein catabolic process | GO:0030163 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Peptidase M14, carboxypeptidase A | IPR000834 | - | 0.0 | - |
| Sma3 | IPR001984 | - | 0.0 | - | |
| Sma3 | CDC48, N-terminal subdomain | IPR003338 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | ATPase, AAA-type, core | IPR003959 | - | 0.0 | - |
| Sma3 | ATPase, AAA-type, conserved site | IPR003960 | - | 0.0 | - |
| Sma3 | CDC48, domain 2 | IPR004201 | - | 0.0 | - |
| Sma3 | 26S proteasome subunit P45 | IPR005937 | - | 0.0 | - |
| Sma3 | ATPase, AAA-type, CDC48 | IPR005938 | - | 0.0 | - |
| Sma3 | Aspartate decarboxylase-like fold | IPR009010 | - | 0.0 | - |
| Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
| Sma3 | Vps4 oligomerisation, C-terminal | IPR015415 | - | 0.0 | - |
| Sma3 | L-lactate dehydrogenase, active site | IPR018177 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G09840.1 | CDC48, ATCDC48, CDC48A cell division cycle 48 chr3:3019494-3022832 FORWARD LENGTH=809 | 5.99756e-43 | 98% |
| RefSeq | Arabidopsis thaliana | NP_187595.1 | cell division control protein 48-A [Arabidopsis thaliana] | 7.00649e-43 | 98% |
| RefSeq | Populus trichocarpa | XP_002318682.1 | predicted protein [Populus trichocarpa] | 7.00649e-43 | 98% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ACE6
Fln msg: Distance to subject end: 187 aas, your sequence is shorter than subject: 73 - 442
Fln protein:
L
Protein Length:
74
Fln nts:
G
Fln Alignment:
AllPine_a_rep_c95584___LQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPERLTMWFGESE
D5ACE6________________LKEAVEWPQKYQHAFLRIGTHPPRGVLMFGPPGCSKTIMARAVASEAGLNFLAVKGPELFSKWVGESE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
