UniGene Name: sp_v3.0_unigene137282
Length: 214 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene137282
A |
Ace file of the UniGene sp_v3.0_unigene137282 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative protein phosphatase 2C 63 [Arabidopsis thaliana] sp|O81760.1|P2C63_ARATH RecName: Full=Probable protein phosphatase 2C 63; Short=AtPP2C63 gb|AAK50092.1|AF372953_1 AT4g33920/F17I5_110 [Arabidopsis thaliana] emb|CAA19874.1| putative protein [Arabid | - | - | 1.0e-17 | 64% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 55% |
Sma3 | Protein phosphatase 2c, putative | - | - | 4.538e-14 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphoprotein phosphatase. | EC:3.1.3.16 | - | 8.036e-27 | - |
Source | Gene names |
---|---|
Sma3 | At3g51370; At4g33920; BIPP2C2; F17I5.110; F26O13.10; GSVIVT00001432001; GSVIVT00014932001; GSVIVT00019625001; GSVIVT00023088001; GSVIVT00025384001; LOC_Os03g04430; LOC_Os03g10950; LOC_Os03g61690; LOC_Os04g49490; LOC_Os06g50380; LOC_Os07g02330; LOC_Os12g39 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine phosphatase complex | GO:0008287 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | phosphoprotein phosphatase activity | GO:0004721 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine phosphatase activity | GO:0004722 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
Sma3 | protein dephosphorylation | GO:0006470 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein phosphatase 2C, manganese/magnesium aspartate binding site | IPR000222 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
Sma3 | Protein phosphatase 2C-like | IPR001932 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Beta tubulin, autoregulation binding site | IPR013838 | - | 0.0 | - |
Sma3 | IPR014045 | - | 0.0 | - | |
Sma3 | Protein phosphatase 2C | IPR015655 | - | 0.0 | - |
Sma3 | Zinc finger, C3HC4 RING-type | IPR018957 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G33920.1 | Protein phosphatase 2C family protein chr4:16260876-16262703 FORWARD LENGTH=380 | 2.0e-23 | 64% |
RefSeq | Arabidopsis thaliana | NP_195118.1 | putative protein phosphatase 2C 63 [Arabidopsis thaliana] | 2.0e-23 | 64% |
RefSeq | Populus trichocarpa | XP_002303382.1 | predicted protein [Populus trichocarpa] | 8.0e-26 | 60% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AA04
Fln msg: Distance to subject end: 174 aas, your sequence is shorter than subject: 71 - 370
Fln protein:
H
Protein Length:
72
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c94923___VTRSWEAQPQIASAGSCCLVGVISNNTLYVANLGDSRAVLGS-TRAKKSIIAERLSTEHNAAEEEVRKDI
D5AA04________________VTNAWPTKPQLAAVGSCCLVGLVYEKTLYVANLGDSRVVMGRLIRATGEIAAVQLSAEHNASMEAVRQEL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain