UniGene Name: sp_v3.0_unigene137155
Length: 213 nt
UniGene Fasta |
---|
>sp_v3.0_unigene137155
T |
Ace file of the UniGene sp_v3.0_unigene137155 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative sinapyl alcohol dehydrogenase (Fragment) n=1 Tax=Cathaya argyrophylla RepID=E5F5N5_9CONI | - | - | 1.0e-21 | 72% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 71% |
Sma3 | Cinnamyl alcohol dehydrogenase | - | - | 1.42e-13 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cinnamyl-alcohol dehydrogenase. | EC:1.1.1.195 | - | 4.607e-13 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phenylpropanoid biosynthesis | 00940 | 4.607e-13 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 4.607e-13 | % | |
Sma3 | Metabolic pathways | 01100 | 4.607e-13 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 4.607e-13 | % | |
Sma3 | Mannitol dehydrogenase. | EC:1.1.1.255 | - | 2.994e-09 | - |
Source | Gene names |
---|---|
Sma3 | AT2G21730; AT4G39330; At2g21730; At4g39330; CAD; CAD1; CAD2; CADL1; CADL10; CADL4; CADL6; CADb; CADb-1; CADb-2; ELI3; Eli3; GEDH1; GSVIVT00008718001; GSVIVT00011484001; GSVIVT00013365001; GSVIVT00036661001; H0209A05.10; OSJNBa0065B15.8; Os04g0229100; OsI_ |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | cinnamyl-alcohol dehydrogenase activity | GO:0045551 | Molecular Function | 0.0 | - |
Sma3 | mannitol dehydrogenase activity | GO:0046029 | Molecular Function | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alcohol dehydrogenase superfamily, zinc-type | IPR002085 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, zinc-type, conserved site | IPR002328 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, C-terminal | IPR013149 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase GroES-like | IPR013154 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G39330.1 | ATCAD9, CAD9 cinnamyl alcohol dehydrogenase 9 chr4:18291268-18292772 FORWARD LENGTH=360 | 1.0e-20 | 55% |
RefSeq | Arabidopsis thaliana | NP_001031812.1 | putative cinnamyl alcohol dehydrogenase 9 [Arabidopsis thaliana] | 3.0e-21 | 55% |
RefSeq | Populus trichocarpa | XP_002300211.1 | cinnamyl alcohol dehydrogenase-like protein [Populus trichocarpa] | 2.0e-20 | 59% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NQK7
Fln msg: Distance to subject end: 61 aas, your sequence is shorter than subject: 70 - 166
Fln protein:
V
Protein Length:
71
Fln nts:
T
Fln Alignment:
AllPine_a_rep_c94632___VISVDEKQMQAAVKSLDYIIDTVSANHPVEPLLSLLKVNGKLVILGLPEKPVQFAAPAVVMGRRFVGGS
A9NQK7________________LVSKDEKQMQDAAKSLDYIIDTVSADHPLLPLLSLLKVNGKLVLVGMPEKPLSLPSVALAAGRRFVGGS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain