|
||||||
|
UniGene Name: sp_v3.0_unigene134298
Length: 239 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene134298
C |
|
Ace file of the UniGene sp_v3.0_unigene134298
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | gamma-aminobutyrate transaminase, putative [Musa acuminata] | - | - | 2.0e-25 | 78% |
| FL-Next | sp=Gamma aminobutyrate transaminase 3, chloroplastic; Solanum lycopersicum (Tomato) (Lycopersicon esculentum). | - | - | 0.0 | 74% |
| Sma3 | Putative aminotransferase | - | - | 6.675e-10 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 4-aminobutyrate transaminase. | EC:2.6.1.19 | - | 4.836e-16 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alanine, aspartate and glutamate metabolism | 00250 | 4.836e-16 | % | |
| Sma3 | beta-Alanine metabolism | 00410 | 4.836e-16 | % | |
| Sma3 | Propanoate metabolism | 00640 | 4.836e-16 | % | |
| Sma3 | Butanoate metabolism | 00650 | 4.836e-16 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.836e-16 | % |
| Source | Gene names |
|---|---|
| Sma3 | At3g22200; GSVIVT00037592001; GSVIVT00037597001; LeGABA-TP1; LeGABA-TP2; LeGABA-TP3; MA4_106O17.66; OJ1119_C05.10; OJ1399_H05.13; OSIGBa0126B18.6; OSIGBa0126B18.7; OSJNBa0008M17.3; OSJNBa0008M17.4; Os02g0112900; Os04g0614500; Os04g0614600; Os08g0205900; O |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | 4-aminobutyrate transaminase activity | GO:0003867 | Molecular Function | 0.0 | - |
| Sma3 | transaminase activity | GO:0008483 | Molecular Function | 0.0 | - |
| Sma3 | pyridoxal phosphate binding | GO:0030170 | Molecular Function | 0.0 | - |
| Sma3 | glutamate decarboxylation to succinate | GO:0006540 | Biological Process | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | gamma-aminobutyric acid catabolic process | GO:0009450 | Biological Process | 0.0 | - |
| Sma3 | pollen tube growth | GO:0009860 | Biological Process | 0.0 | - |
| Sma3 | pollen tube adhesion | GO:0009865 | Biological Process | 0.0 | - |
| Sma3 | response to organic substance | GO:0010033 | Biological Process | 0.0 | - |
| Sma3 | fruit development | GO:0010154 | Biological Process | 0.0 | - |
| Sma3 | pollen tube guidance | GO:0010183 | Biological Process | 0.0 | - |
| Sma3 | beta-alanine catabolic process | GO:0019484 | Biological Process | 0.0 | - |
| Sma3 | shoot system development | GO:0022621 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aminotransferase class-III | IPR005814 | - | 0.0 | - |
| Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 1 | IPR015421 | - | 0.0 | - |
| Sma3 | Peptidase C14, ICE, catalytic subunit p20, active site | IPR016129 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G22200.2 | POP2 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein chr3:7835457-7838863 FORWARD LENGTH=513 | 1.0e-29 | 73% |
| RefSeq | Arabidopsis thaliana | NP_566700.1 | gamma-aminobutyrate transaminase-like protein [Arabidopsis thaliana] | 1.0e-29 | 73% |
| RefSeq | Populus trichocarpa | XP_002322549.1 | predicted protein [Populus trichocarpa] | 5.0e-34 | 81% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q84P52
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 355 aas, your sequence is shorter than subject: 79 - 520
Fln protein:
S
Protein Length:
80
Fln nts:
C
Fln Alignment:
AllPine_a_rep_c90242___VYDTNGNKYLDALAGLWCRRLVGCDSRLVAAATEQLNKLPFYHSFWNRTTQPSLDLAKEVLETFKANKMSK
Q84P52________________VYDVNGKKYLDALAGLWCTSLGGNEPRLVAAATKQLNELAFYHSFWNRSTKPSLDLAKELLDLFTANKMAK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
