UniGene Name: sp_v3.0_unigene131943
Length: 238 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene131943
C |
Ace file of the UniGene sp_v3.0_unigene131943
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | prolyl-tRNA synthetase [Arabidopsis thaliana] ref|NP_850736.1| prolyl-tRNA synthetase [Arabidopsis thaliana] emb|CAB71872.1| multifunctional aminoacyl-tRNA ligase-like protein [Arabidopsis thaliana] gb|AAL24294.1| multifunctional aminoacyl-tRNA ligase-lik | - | - | 3.0e-23 | 85% |
| FL-Next | tr=Uncharacterized protein; Glycine max (Soybean) (Glycine hispida). | - | - | 0.0 | 89% |
| Sma3 | Bifunctional aminoacyl-tRNA synthetase | - | - | 7.483e-09 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Proline--tRNA ligase. | EC:6.1.1.15 | - | 2.245e-08 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aminoacyl-tRNA biosynthesis | 00970 | 2.245e-08 | % |
| Source | Gene names |
|---|---|
| Sma3 | At3g62120; CHLREDRAFT_186253; EPRS; GSVIVT00028238001; LOC_Os12g25710; MICPUCDRAFT_48477; MICPUN_84342; OSTLU_19561; Os12g0443700; OsI_38226; OsJ_35987; Ot06g02740; PHATRDRAFT_23547; PHYPADRAFT_113773; POPTRDRAFT_1098845; POPTRDRAFT_552617; RCOM_1343320; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | proline-tRNA ligase activity | GO:0004827 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | prolyl-tRNA aminoacylation | GO:0006433 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aminoacyl-tRNA synthetase, class II (G/ H/ P/ S), conserved domain | IPR002314 | - | 0.0 | - |
| Sma3 | Prolyl-tRNA synthetase, class IIa | IPR002316 | - | 0.0 | - |
| Sma3 | Glutathione S-transferase, C-terminal | IPR004046 | - | 0.0 | - |
| Sma3 | Anticodon-binding | IPR004154 | - | 0.0 | - |
| Sma3 | Prolyl-tRNA synthetase, class IIa, archaeal-type | IPR004499 | - | 0.0 | - |
| Sma3 | Aminoacyl-tRNA synthetase, class II | IPR006195 | - | 0.0 | - |
| Sma3 | YbaK/aminoacyl-tRNA synthetase-associated domain | IPR007214 | - | 0.0 | - |
| Sma3 | Glutathione S-transferase, C-terminal-like | IPR010987 | - | 0.0 | - |
| Sma3 | Prolyl-tRNA synthetase, class II, C-terminal | IPR016061 | - | 0.0 | - |
| Sma3 | Glutathione S-transferase/chloride channel, C-terminal | IPR017933 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G62120.1 | Class II aaRS and biotin synthetases superfamily protein chr3:23001227-23003849 REVERSE LENGTH=530 | 1.0e-26 | 85% |
| RefSeq | Arabidopsis thaliana | NP_850736.1 | prolyl-tRNA synthetase [Arabidopsis thaliana] | 2.0e-26 | 85% |
| RefSeq | Populus trichocarpa | XP_002301553.1 | predicted protein [Populus trichocarpa] | 2.0e-28 | 89% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: I1NBI3
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 132 aas, your sequence is shorter than subject: 79 - 410
Fln protein:
V
Protein Length:
80
Fln nts:
C
Fln Alignment:
AllPine_a_rep_c85737___VFGGKKSEVEKFAGGLYTTTVEAFIPNTGRGIQGATSHCLGQNFAKMFEIRFENER
I1NBI3________________VIKGKKSELEKFAGGLYTTSVEAFIPNTGRGIQGATSHCLGQNFAKMFEINFENEK

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta