|
||||||
|
UniGene Name: sp_v3.0_unigene130590
Length: 137 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene130590
A |
|
Ace file of the UniGene sp_v3.0_unigene130590 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | CLV1-like LRR receptor kinase (Fragment) n=1 Tax=Musa acuminata subsp. malaccensis RepID=Q2PXX2_MUSAC | - | - | 3.0e-13 | 77% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 62% |
| Sma3 | Leucine-rich repeat receptor-like protein kinase | - | - | 4.372e-29 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 3.504e-11 | - |
| Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 5.996e-13 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G28440; AT1G34110; AT1G75820; AT2G33170; AT3G49670; AT4G20140; AT4G28490; AT4G28650; AT4G29180; AT4g20140; AT4g29180; AT5G07180; AT5G49660; AT5G62230; AT5G62710; AT5G63930; AT5G65700; AT5G65710; At1g17230; At1g17230/F20D23_7; At1g28440; At1g75820; At2g |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | epidermis development | GO:0008544 | Biological Process | 0.0 | - |
| Sma3 | embryo sac development | GO:0009553 | Biological Process | 0.0 | - |
| Sma3 | embryo development | GO:0009790 | Biological Process | 0.0 | - |
| Sma3 | regulation of meristem structural organization | GO:0009934 | Biological Process | 0.0 | - |
| Sma3 | regulation of meristem growth | GO:0010075 | Biological Process | 0.0 | - |
| Sma3 | stomatal complex morphogenesis | GO:0010103 | Biological Process | 0.0 | - |
| Sma3 | microsporocyte differentiation | GO:0010480 | Biological Process | 0.0 | - |
| Sma3 | cell differentiation | GO:0030154 | Biological Process | 0.0 | - |
| Sma3 | interspecies interaction between organisms | GO:0044419 | Biological Process | 0.0 | - |
| Sma3 | protein autophosphorylation | GO:0046777 | Biological Process | 0.0 | - |
| Sma3 | gametophyte development | GO:0048229 | Biological Process | 0.0 | - |
| Sma3 | ovule development | GO:0048481 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Enolpyruvate transferase domain | IPR001986 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat, typical subtype | IPR003591 | - | 0.0 | - |
| Sma3 | Aminotransferases, class-I, pyridoxal-phosphate-binding site | IPR004838 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | HTH domain AraC-type, conserved site | IPR018062 | - | 0.0 | - |
| Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G28490.1 | RLK5, HAE Leucine-rich receptor-like protein kinase family protein chr4:14077894-14080965 FORWARD LENGTH=999 | 1.0e-15 | 74% |
| RefSeq | Arabidopsis thaliana | NP_194578.1 | receptor-like protein kinase 5 [Arabidopsis thaliana] | 1.0e-15 | 74% |
| RefSeq | Populus trichocarpa | XP_002328032.1 | predicted protein [Populus trichocarpa] | 1.0e-17 | 77% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LPH3
Fln msg: Distance to subject end: 144 aas, your sequence is shorter than subject: 45 - 360
Fln protein:
C
Protein Length:
46
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c83067___RHRIALDSAQGLSYLHHDCLPPIVHRDIKSNNILLDDKLQASV
B8LPH3________________RNKIALGSARGIAYLHHDCIPHIIHRDIKSSNILLDEEMEARI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
