SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene124936

Length: 256 nt

UniGene Fasta

>sp_v3.0_unigene124936
GGGACCAGCGCACTTGTCGCAGTGAAGAGAATCTCCGCTGGTTCAAGACAGGGGGAGCGGGAATTCATGTCGGAAATCAGTACCATAGGCCGACTTCGACACAGGAACTTGGTGCGACTCCAAGGGTGGTGCCACGAACGCGACGAGCTACTGCTCGTCTACGACTACATGCCCAATGGGAGCCTCGACAAGATCATCTTCAGGCAGCCAGGGGATGAACAGCAGAATCAGCACCAGCCCCCTTTGGATTGGGTTC

Ace file of the UniGene sp_v3.0_unigene124936

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Kinase-like protein (Fragment) n=4 Tax=Corylus avellana RepID=C7A7Q0_CORAV	-	-	1.0e-22	63%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	60%
Sma3	Kinase, putative	-	-	3.658e-25	-

Source	ECs	Term	Type	e value	Identity
Sma3	Non-specific protein-tyrosine kinase.	EC:2.7.10.2	-	4.03e-11	-
Sma3	Cyclin-dependent kinase.	EC:2.7.11.22	-	2.572e-10	-

Source	Gene names
Sma3	117M18_32; AT4g02410; AT4g02420; AT4g29050; At1g15530; At1g70130; At2g37710; At2g43690; At2g43700; At3g08870; At3g53380; At3g53810; At3g59700; At3g59730; At3g59750; At4g02410; At4g02420; At4g29050; At5g01540; At5g01550; At5g01560; At5g06740; At5g10530; At

Source	GOs	Term	Type	Identity
Sma3	chromatin	GO:0000785	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	cell surface	GO:0009986	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	chromatin binding	GO:0003682	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	protein kinase activity	GO:0004672	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	protein tyrosine kinase activity	GO:0004713	Molecular Function	-
Sma3	receptor activity	GO:0004872	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	sugar binding	GO:0005529	Molecular Function	-
Sma3	RNA-dependent DNA replication	GO:0006278	Biological Process	-
Sma3	chromatin assembly or disassembly	GO:0006333	Biological Process	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	abscisic acid mediated signaling pathway	GO:0009738	Biological Process	-
Sma3	response to salicylic acid stimulus	GO:0009751	Biological Process	-
Sma3	seed germination	GO:0009845	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain	IPR000194	-	-
Sma3	Protease inhibitor I4, serpin	IPR000215	-	-
Sma3	Reverse transcriptase	IPR000477	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Chromo domain/shadow	IPR000953	-	-
Sma3	Legume lectin, alpha chain, conserved site	IPR000985	-	-
Sma3	Legume lectin domain	IPR001220	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Zinc finger, RING-type	IPR001841	-	-
Sma3		IPR001899	-	-
Sma3	Peptidase aspartic, active site	IPR001969	-	-
Sma3	Serine/threonine- / dual-specificity protein kinase, catalytic domain	IPR002290	-	-
Sma3	Ribosomal protein L10, eubacterial, conserved site	IPR002363	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Retroviral aspartyl protease	IPR013242	-	-
Sma3	Concanavalin A-like lectin/glucanase, subgroup	IPR013320	-	-
Sma3	SKG6/AXL2 alpha-helix transmembrane domain	IPR014805	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Zinc finger, C3HC4 RING-type	IPR018957	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G43700.1	Concanavalin A-like lectin protein kinase family protein chr2:18116523-18118499 FORWARD LENGTH=658	3.0e-26	60%
RefSeq	Arabidopsis thaliana	NP_181898.1	concanavalin A-like lectin protein kinase-like protein [Arabidopsis thaliana]	4.0e-26	60%
RefSeq	Populus trichocarpa	XP_002324854.1	predicted protein, partial [Populus trichocarpa]	2.0e-25	68%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9NVC0

Fln msg: Distance to subject end: 177 aas, your sequence is shorter than subject: 85 - 636

Fln protein: GTSALVAVKRISAGSRQGEREFMSEISTIGRLRHRNLVRLQGWCHERDELLLVYDYMPNGSLDKIIFRQPGDEQQNQHQPPLDWV

Protein Length: 86

Fln nts: GGGACCAGCGCACTTGTCGCAGTGAAGAGAATCTCCGCTGGTTCAAGACAGGGGGAGCGGGAATTCATGTCGGAAATCAGTACCATAGGCCGACTTCGACACAGGAACTTGGTGCGACTCCAAGGGTGGTGCCACGAACGCGACGAGCTACTGCTCGTCTACGACTACATGCCCAATGGGAGCCTCGACAAGATCATCTTCAGGCAGCCAGGGGATGAACAGCAGAATCAGCACCAGCCCCCTTTGGATTGGGTTC

Fln Alignment:

AllPine_a_c61748___VAVKRISAGSRQGEREFMSEISTIGRLRHRNLVRLQGWCHERDELLLVYDYMPNGSLDKIIFRQP
A9NVC0________________VAVKCITTEFTEGMKGFVAEISSMGRLRHRNLVQLRGWCRRHTQLFIVYDYMPNGSLDKLIFGNP

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain