UniGene Name: sp_v3.0_unigene124635
Length: 159 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene124635
T |
Ace file of the UniGene sp_v3.0_unigene124635 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Putative MYB transcription factor n=1 Tax=Rosa rugosa RepID=F2QKW4_ROSRU | - | - | 2.0e-08 | 78% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
| Sma3 | MYB-like DNA-binding domain protein | - | - | 5.256e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g22640; At2g16720; At3g13540; At3g27920; At4g09460; At4g34990; At5g14750; At5g40330; At5g52600; F12K8.1; F6N7.8; GL1; GL1A; GSVIVT00006679001; GSVIVT00008644001; GSVIVT00009522001; GSVIVT00017797001; GSVIVT00017798001; GSVIVT00020733001; GSVIVT00022367 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
| Sma3 | transcription regulator activity | GO:0030528 | Molecular Function | 0.0 | - |
| Sma3 | cell fate specification | GO:0001708 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | multicellular organismal development | GO:0007275 | Biological Process | 0.0 | - |
| Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
| Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
| Sma3 | gibberellic acid mediated signaling pathway | GO:0009740 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | cinnamic acid biosynthetic process | GO:0009800 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of metabolic process | GO:0009892 | Biological Process | 0.0 | - |
| Sma3 | trichome morphogenesis | GO:0010090 | Biological Process | 0.0 | - |
| Sma3 | trichome branching | GO:0010091 | Biological Process | 0.0 | - |
| Sma3 | regulation of protein localization | GO:0032880 | Biological Process | 0.0 | - |
| Sma3 | cell fate commitment | GO:0045165 | Biological Process | 0.0 | - |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | mucilage biosynthetic process involved in seed coat development | GO:0048354 | Biological Process | 0.0 | - |
| Sma3 | trichome patterning | GO:0048629 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
| Sma3 | Peptidase C48, SUMO/Sentrin/Ubl1 | IPR003653 | - | 0.0 | - |
| Sma3 | Transposon, En/Spm-like | IPR004242 | - | 0.0 | - |
| Sma3 | IPR012287 | - | 0.0 | - | |
| Sma3 | IPR014778 | - | 0.0 | - | |
| Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
| Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G06180.1 | ATMYB13, ATMYBLFGN, MYB13 myb domain protein 13 chr1:1889510-1891089 FORWARD LENGTH=246 | 2.0e-12 | 68% |
| RefSeq | Arabidopsis thaliana | NP_172108.1 | myb proto-oncogene protein [Arabidopsis thaliana] | 2.0e-12 | 68% |
| RefSeq | Populus trichocarpa | XP_002301694.1 | predicted protein [Populus trichocarpa] | 8.0e-13 | 83% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLD7
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 153 aas, your sequence is shorter than subject: 36 - 295
Fln protein:
N
Protein Length:
37
Fln nts:
T
Fln Alignment:
AllPine_a_c61381___NRWSLIAERMPGRTDNEIKNYWRCHLKKKL
B8LLD7________________NRWSLIAEKMPGRTDNEIKNYWRSHLKKKL

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)