UniGene Name: sp_v3.0_unigene122945
Length: 148 nt
UniGene Fasta |
---|
>sp_v3.0_unigene122945
T |
Ace file of the UniGene sp_v3.0_unigene122945 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] gb|AAL38840.1| unknown protein [Arabidopsis thaliana] gb|AEE33400.1| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] | - | - | 4.0e-16 | 75% |
FL-Next | tr=Putative uncharacterized protein; Selaginella moellendorffii (Spikemoss). | - | - | 0.0 | 79% |
Sma3 | HAD-superfamily hydrolase, subfamily IA, variant 3 containing protein, expressed | - | - | 4.755e-08 | - |
Source | Gene names |
---|---|
Sma3 | At1g56500; F13N6.21; GSVIVT00022589001; LOC_Os03g19760; Os03g0311300; OsI_07299; OsJ_10596; PHYPADRAFT_128572; POPTRDRAFT_1096018; RCOM_1435490; VITISV_030553; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | antioxidant activity | GO:0016209 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity | GO:0016787 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | LDLR class B repeat | IPR000033 | - | 0.0 | - |
Sma3 | Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant | IPR000866 | - | 0.0 | - |
Sma3 | NHL repeat | IPR001258 | - | 0.0 | - |
Sma3 | Haloacid dehalogenase/epoxide hydrolase | IPR005833 | - | 0.0 | - |
Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
Sma3 | HAD-superfamily hydrolase, subfamily IA, variant 3 | IPR006402 | - | 0.0 | - |
Sma3 | Six-bladed beta-propeller, TolB-like | IPR011042 | - | 0.0 | - |
Sma3 | IPR012335 | - | 0.0 | - | |
Sma3 | NHL repeat, subgroup | IPR013017 | - | 0.0 | - |
Sma3 | Redoxin | IPR013740 | - | 0.0 | - |
Sma3 | IPR017936 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G56500.1 | haloacid dehalogenase-like hydrolase family protein chr1:21159775-21167092 FORWARD LENGTH=1055 | 3.0e-21 | 75% |
RefSeq | Arabidopsis thaliana | NP_564718.2 | haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] | 4.0e-21 | 75% |
RefSeq | Populus trichocarpa | XP_002319481.1 | predicted protein [Populus trichocarpa] | 1.0e-19 | 70% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: D8RU18
Fln msg: Distance to subject end: 505 aas, your sequence is shorter than subject: 49 - 1049
Fln protein:
W
Protein Length:
50
Fln nts:
T
Fln Alignment:
AllPine_a_c59227___WRELGVNSWPTFVVVSPNGKLLAQLAGEGHRQDLDDFVEAALQFYGEK
D8RU18________________WRQLGVSSWPTFVVVSPNGKVIARLAGEGHRKDLDNLVDAALQYYGEK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain