|
||||||
|
UniGene Name: sp_v3.0_unigene119827
Length: 224 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene119827
T |
|
Ace file of the UniGene sp_v3.0_unigene119827
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | FACT complex subunit SPT16, putative n=1 Tax=Ricinus communis RepID=B9RFP6_RICCO | - | - | 1.0e-20 | 78% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 73% |
| Sma3 | Facilitates chromatin transcription complex subunit SPT16 | - | - | 6.203e-13 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g10670; At4g10670; At4g10710; CHLREDRAFT_133193; GSVIVT00022540001; GSVIVT00022541001; GTC102; GTC1501; GTC901; GTC903; GTC904; LOC_Os12g26030; MICPUN_55454; Os04g0321600; Os12g0446500; OsI_38208; OsJ_14260; OsJ_27240; OsJ_35969; Ot12g02060; PHYPADRAFT |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | chromosome | GO:0005694 | Cellular Component | 0.0 | - |
| Sma3 | nuclear euchromatin | GO:0005719 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | FACT complex | GO:0035101 | Cellular Component | 0.0 | - |
| Sma3 | translation elongation factor activity | GO:0003746 | Molecular Function | 0.0 | - |
| Sma3 | DNA replication | GO:0006260 | Biological Process | 0.0 | - |
| Sma3 | DNA repair | GO:0006281 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | cellular process | GO:0009987 | Biological Process | 0.0 | - |
| Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase M24, structural domain | IPR000994 | - | 0.0 | - |
| Sma3 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR001917 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF1747 | IPR013719 | - | 0.0 | - |
| Sma3 | FACT complex subunit Spt16p/Cdc68p | IPR013953 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G10710.1 | SPT16 global transcription factor C chr4:6602226-6605450 REVERSE LENGTH=1074 | 8.0e-21 | 73% |
| RefSeq | Arabidopsis thaliana | NP_192809.1 | FACT complex subunit SPT16 [Arabidopsis thaliana] | 1.0e-20 | 73% |
| RefSeq | Populus trichocarpa | XP_002318930.1 | global transcription factor group [Populus trichocarpa] | 9.0e-23 | 78% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ABN5
Fln msg: Separated hits, possible frame ERROR between 139 and 145, Distance to subject end: 273 aas, your sequence is shorter than subject: 74 - 372
Fln protein:
I
Protein Length:
75
Fln nts:
T
Fln Alignment:
AllPine_a_c55430___IAYKNIKHAFFQPADKEMITLVHFHLHNCVMVGNNKTKDVQFYAKVxxVIATSGNGKRSVYDPDEVEVEQQETD
D5ABN5________________VMYQNIKHAFFQPAEKEMITLLHFHLHNHIMVGTKKTKDVQFFVEVxxVVQTLGGARRSMYDPDEIEEEQQERD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
