UniGene Name: sp_v3.0_unigene119246
Length: 114 nt
![]() |
---|
>sp_v3.0_unigene119246
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | protein dicer-like 2 [Arabidopsis thaliana] ref|NP_001189798.1| protein dicer-like 2 [Arabidopsis thaliana] sp|Q3EBC8.2|DCL2_ARATH RecName: Full=Endoribonuclease Dicer homolog 2; AltName: Full=Dicer-like protein 2; Short=AtDCL2 gb|AEE73924.1| protein dice | - | - | 5.0e-08 | 74% |
FL-Next | Isoform 2 of Endoribonuclease Dicer homolog 2 OS=Arabidopsis thaliana GN=At3g03300 | - | - | 0.0 | 74% |
Sma3 | Dicer-like protein | - | - | 1.312e-13 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribonuclease III. | EC:3.1.26.3 | - | 7.041e-07 | - |
Source | Gene names |
---|---|
Sma3 | At3g03300; At5g20320; DCL4; DCL901; DCL903; DCL905; F5O24.210; GSVIVT00005618001; GSVIVT00025032001; LOC_Os03g38740; OJ1785_A05.30; OSIGBa0157K09-H0214G12.2; OSJNBa0057D11.8-1; OSJNBb0065L13.5; OSJNBb0079G12.35-1; Os03g0583900; OsI_12390; OsI_16596; OsJ_1 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | double-stranded RNA binding | GO:0003725 | Molecular Function | 0.0 | - |
Sma3 | helicase activity | GO:0004386 | Molecular Function | 0.0 | - |
Sma3 | ribonuclease III activity | GO:0004525 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
Sma3 | RNA processing | GO:0006396 | Biological Process | 0.0 | - |
Sma3 | virus induced gene silencing | GO:0009616 | Biological Process | 0.0 | - |
Sma3 | vegetative phase change | GO:0010050 | Biological Process | 0.0 | - |
Sma3 | maintenance of DNA methylation | GO:0010216 | Biological Process | 0.0 | - |
Sma3 | production of ta-siRNAs involved in RNA interference | GO:0010267 | Biological Process | 0.0 | - |
Sma3 | production of lsiRNA involved in RNA interference | GO:0010599 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Protease inhibitor I4, serpin | IPR000215 | - | 0.0 | - |
Sma3 | Ribonuclease III domain | IPR000999 | - | 0.0 | - |
Sma3 | Double-stranded RNA-binding | IPR001159 | - | 0.0 | - |
Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
Sma3 | Argonaute/Dicer protein, PAZ | IPR003100 | - | 0.0 | - |
Sma3 | Metallophosphoesterase domain | IPR004843 | - | 0.0 | - |
Sma3 | Dicer double-stranded RNA-binding fold | IPR005034 | - | 0.0 | - |
Sma3 | Helicase/UvrB domain | IPR006935 | - | 0.0 | - |
Sma3 | DNA/RNA helicase, DEAD/DEAH box type, N-terminal | IPR011545 | - | 0.0 | - |
Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
Sma3 | IPR014021 | - | 0.0 | - | |
Sma3 | Double-stranded RNA-binding-like | IPR014720 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G03300.1 | DCL2, ATDCL2 dicer-like 2 chr3:768020-774833 REVERSE LENGTH=1388 | 5.0e-12 | 74% |
RefSeq | Arabidopsis thaliana | NP_001078101.1 | protein dicer-like 2 [Arabidopsis thaliana] | 6.0e-12 | 74% |
RefSeq | Populus trichocarpa | XP_002312197.1 | dicer-like protein [Populus trichocarpa] | 2.0e-11 | 80% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q3EBC8-2
Fln msg: Distance to subject end: 893 aas, your sequence is shorter than subject: 38 - 1374
Fln protein:
I
Protein Length:
39
Fln nts:
A
Fln Alignment:
AllPine_a_c54684___IEEGLDIQGCSLVIRFDLSDTVCSFIQSRGRARMQ
Q3EBC8-2______________LEEGLDVQSCNLVIRFDPASNICSFIQSRGRARMQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain