UniGene Name: sp_v3.0_unigene118254
Length: 213 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene118254
T |
Ace file of the UniGene sp_v3.0_unigene118254 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | WRKY35 transcription factor n=1 Tax=Brassica napus RepID=C4N1L4_BRANA | - | - | 6.0e-20 | 82% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 66% |
Sma3 | WRKY transcription factor, putative | - | - | 1.087e-17 | - |
Source | Gene names |
---|---|
Sma3 | A_IG002N01.6; At1g29280; At1g30650; At2g30590; At2g34830; At3g58710; At4g01250; At4g23550; At4g24240; At5g45050; At5g52830; F19I3.6; F2N1.6; GSVIVT00002171001; GSVIVT00002535001; GSVIVT00007309001; GSVIVT00018784001; GSVIVT00019549001; GSVIVT00023389001; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | intrinsic to membrane | GO:0031224 | Cellular Component | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | transmembrane signaling receptor activity | GO:0004888 | Molecular Function | 0.0 | - |
Sma3 | calmodulin binding | GO:0005516 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Sma3 | response to virus | GO:0009615 | Biological Process | 0.0 | - |
Sma3 | plant-type hypersensitive response | GO:0009626 | Biological Process | 0.0 | - |
Sma3 | response to chitin | GO:0010200 | Biological Process | 0.0 | - |
Sma3 | innate immune response | GO:0045087 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Toll/interleukin-1 receptor homology (TIR) domain | IPR000157 | - | 0.0 | - |
Sma3 | Major intrinsic protein | IPR000425 | - | 0.0 | - |
Sma3 | NB-ARC | IPR002182 | - | 0.0 | - |
Sma3 | DNA-binding WRKY | IPR003657 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | Leucine-rich repeat 3 | IPR011713 | - | 0.0 | - |
Sma3 | Transcription factor, WRKY group Iie | IPR017412 | - | 0.0 | - |
Sma3 | Zn-cluster domain | IPR018872 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G29280.1 | WRKY65, ATWRKY65 WRKY DNA-binding protein 65 chr1:10236589-10237467 FORWARD LENGTH=259 | 1.0e-26 | 80% |
RefSeq | Arabidopsis thaliana | NP_174222.2 | putative WRKY transcription factor 65 [Arabidopsis thaliana] | 2.0e-26 | 80% |
RefSeq | Populus trichocarpa | XP_002299016.1 | predicted protein [Populus trichocarpa] | 3.0e-25 | 80% |
Full-Lengther Next Prediction |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LKE9
Fln msg: STOP codon was not found. Distance to subject end: 13 aas, your sequence is shorter than subject: 70 - 335
Fln protein:
K
Protein Length:
71
Fln nts:
T
Fln Alignment:
AllPine_a_c53451___KGSPYPRGYYRCSSCKGCPARKQVERSHTDPTKLVITYTAEHNHA
B8LKE9________________KGSPYPRGYYKCSSMRGCPARKHVERCLDEPSMLIVTYEGEHNHS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain