UniGene Name: sp_v3.0_unigene117651
Length: 230 nt
UniGene Fasta |
---|
>sp_v3.0_unigene117651
T |
Ace file of the UniGene sp_v3.0_unigene117651 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Pol protein integrase region (Fragment) n=1 Tax=Pinus brutia RepID=Q9M6N4_9CONI | - | - | 1.0e-24 | 75% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 60% |
Sma3 | Pol protein integrase region | - | - | 4.483e-09 | - |
Source | Gene names |
---|---|
Sma3 | LOC_Os10g28310; LOC_Os11g20270; LOC_Os11g45000; Os01g0640000; Os02g0309600; Os05g0456700; Os10g0419000; Os12g0450200; T21B14.24; T9I1.13; VITISV_001568; VITISV_002634; VITISV_011228; VITISV_011880; VITISV_012031; VITISV_013478; VITISV_020633; VITISV_02668 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | carbonate dehydratase activity | GO:0004089 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | carbon utilization | GO:0015976 | Biological Process | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5CAF3
Fln msg: Distance to subject end: 324 aas, your sequence is shorter than subject: 76 - 672
Fln protein:
S
Protein Length:
77
Fln nts:
T
Fln Alignment:
AllPine_a_c52716___SSITVVVDRISKYARFYALPHPITPTLVAQVFMDQIFKLHGMLTSIVSDRDPTFTRKFWQEILKLQGTQLQLST
A5CAF3________________TAIFVVVDRLTKYGHFMLLPHPYTTKMVAQVFLDSVYKLHGLPYSITCDRDPIFTSVFWQEFFKLQGVSLQLST
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain