|
||||||
|
UniGene Name: sp_v3.0_unigene115558
Length: 166 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene115558
T |
|
Ace file of the UniGene sp_v3.0_unigene115558
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | RVT_1 domain containing protein | - | - | 2.0e-05 | 20% |
| FL-Next | sp=RNA-directed DNA polymerase homolog; berteroana). Mitochondrion. | - | - | 0.0 | 39% |
| Source | Gene names |
|---|---|
| Sma3 | GSVIVT00005459001; GSVIVT00005481001; GSVIVT00005536001; GSVIVT00005553001; GSVIVT00008081001; GSVIVT00009118001; LOC_Os03g41624; OSJNBa0042D13.18; OSJNBb0007E22.28; OSJNBb0021I10.3; OSJNBb0060M15.10; VITISV_000019; VITISV_000420; VITISV_000545; VITISV_00 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | fatty acid biosynthetic process | GO:0006633 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| RefSeq | Populus trichocarpa | XP_002336419.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-11 | 47% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P31843
Fln msg: Distance to subject end: 22 aas, your sequence is shorter than subject: 55 - 142
Fln protein:
F
Protein Length:
56
Fln nts:
T
Fln Alignment:
AllPine_a_c50253___WGTYAYRVLPFGLSNAPATF*TTVLGIFSDLIHDYVEVYMDEFTVY
P31843________________YGSFEFRVMPFGLTNALATFCNLMNNVLYEYLDHFVVVYLDDLVVY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
