SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene114361

Length: 210 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene114361
AGGCTCTGAGATTCTTTGAGCAGATGCAACTGGTTGGCATGCAGCCTAATGACATCACCTTCATTTGCATTCTCTCAGCATGCAGTCATGTCGGTTTAGTGAATGAAGGCCGCAACTACTTTAATTCCATGAGTCGTAACCATAACATTAAACCAAGAATGGAACACTACGCTTGCATGGTTGATCTACTTAGCCGTGCTGGATTCTTGT

Ace file of the UniGene sp_v3.0_unigene114361 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp\|Q5G1T1.1\|PP272_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g49170, chloroplastic; AltName: Full=Protein EMBRYO DEFECTIVE 2261; Flags: Precursor gb\|AAW62962.1\| emb	-	-	5.0e-19	64%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	62%
Sma3	Pentatricopeptide (PPR) repeat-containing protein-like	-	-	1.639e-08	-

Source	Gene names
Sma3	At2g01510; At2g33680; At3g16610; At3g46790; At3g49170; At4g02750; At4g37380; At4g38010; At5g56310; At5g66520; B1045D11.23; B1120F06.125; CRR2; EMB2261; F20D10.130; F2I9.13; F2K15.30; F6G17.30; GSVIVT00000282001; GSVIVT00000887001; GSVIVT00002423001; GSVIV

Source	GOs	Term	Type	Identity
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	diacylglycerol kinase activity	GO:0004143	Molecular Function	-
Sma3	ubiquitin thiolesterase activity	GO:0004221	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	methyltransferase activity	GO:0008168	Molecular Function	-
Sma3	deaminase activity	GO:0019239	Molecular Function	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	ubiquitin-dependent protein catabolic process	GO:0006511	Biological Process	-
Sma3	transport	GO:0006810	Biological Process	-
Sma3	activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway	GO:0007205	Biological Process	-
Sma3	purine ribonucleoside monophosphate biosynthetic process	GO:0009168	Biological Process	-
Sma3	embryo development ending in seed dormancy	GO:0009793	Biological Process	-
Sma3	chloroplast RNA processing	GO:0031425	Biological Process	-
Sma3	polycistronic mRNA processing	GO:0031426	Biological Process	-
Sma3	methylation	GO:0032259	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Ribonuclease P	IPR000100	-	-
Sma3	Oligopeptide transporter	IPR000109	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Diacylglycerol kinase, accessory domain	IPR000756	-	-
Sma3	Beta-lactamase, class-A/D	IPR000871	-	-
Sma3	Tobamoviral movement protein	IPR001022	-	-
Sma3	Diacylglycerol kinase, catalytic domain	IPR001206	-	-
Sma3	Adenosine/AMP deaminase domain	IPR001365	-	-
Sma3	Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1	IPR001578	-	-
Sma3	DNA methylase, N-6 adenine-specific, conserved site	IPR002052	-	-
Sma3	Pentatricopeptide repeat	IPR002885	-	-
Sma3	Immunoglobulin/major histocompatibility complex, conserved site	IPR003006	-	-
Sma3	Putative methylase	IPR004557	-	-
Sma3	Protein of unknown function DUF569	IPR007679	-	-
Sma3	Methyltransferase small	IPR007848	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Protein of unknown function DUF866, eukaryotic	IPR008584	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-
Sma3	EGF-like region, conserved site	IPR013032	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Thioredoxin, conserved site	IPR017937	-	-
Sma3		IPR018169	-	-
Sma3	Asp/Glu racemase, active site	IPR018187	-	-
Sma3	WD40 repeat, conserved site	IPR019775	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT3G49170.1	EMB2261 Tetratricopeptide repeat (TPR)-like superfamily protein chr3:18226954-18229600 REVERSE LENGTH=850	3.0e-24	64%
RefSeq	Arabidopsis thaliana	NP_190486.2	pentatricopeptide repeat-containing protein [Arabidopsis thaliana]	3.0e-24	64%
RefSeq	Populus trichocarpa	XP_002331135.1	predicted protein [Populus trichocarpa]	2.0e-24	64%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9P0W0

Fln msg: Distance to subject end: 219 aas, your sequence is shorter than subject: 69 - 370

Fln protein: ALRFFEQMQLVGMQPNDITFICILSACSHVGLVNEGRNYFNSMSRNHNIKPRMEHYACMVDLLSRAGFL

Protein Length: 70

Fln nts: AGGCTCTGAGATTCTTTGAGCAGATGCAACTGGTTGGCATGCAGCCTAATGACATCACCTTCATTTGCATTCTCTCAGCATGCAGTCATGTCGGTTTAGTGAATGAAGGCCGCAACTACTTTAATTCCATGAGTCGTAACCATAACATTAAACCAAGAATGGAACACTACGCTTGCATGGTTGATCTACTTAGCCGTGCTGGATTCTTGT

Fln Alignment:

AllPine_a_c48765___ALRFFEQMQLVGMQPNDITFICILSACSHVGLVNEGRNYFNSMSRNHNIKPRMEHYACMVDLLSRAGFL
A9P0W0________________AVLLFEQMLQTGVKPNQITFVVVLSGCSHAGLVDEGRNYFDSMTRDHGISPKAEHYSCMVDLFGRAGCL

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain