UniGene Name: sp_v3.0_unigene114361
Length: 210 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene114361
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q5G1T1.1|PP272_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g49170, chloroplastic; AltName: Full=Protein EMBRYO DEFECTIVE 2261; Flags: Precursor gb|AAW62962.1| emb | - | - | 5.0e-19 | 64% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 62% |
Sma3 | Pentatricopeptide (PPR) repeat-containing protein-like | - | - | 1.639e-08 | - |
Source | Gene names |
---|---|
Sma3 | At2g01510; At2g33680; At3g16610; At3g46790; At3g49170; At4g02750; At4g37380; At4g38010; At5g56310; At5g66520; B1045D11.23; B1120F06.125; CRR2; EMB2261; F20D10.130; F2I9.13; F2K15.30; F6G17.30; GSVIVT00000282001; GSVIVT00000887001; GSVIVT00002423001; GSVIV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | diacylglycerol kinase activity | GO:0004143 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway | GO:0007205 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | chloroplast RNA processing | GO:0031425 | Biological Process | 0.0 | - |
Sma3 | polycistronic mRNA processing | GO:0031426 | Biological Process | 0.0 | - |
Sma3 | methylation | GO:0032259 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G49170.1 | EMB2261 Tetratricopeptide repeat (TPR)-like superfamily protein chr3:18226954-18229600 REVERSE LENGTH=850 | 3.0e-24 | 64% |
RefSeq | Arabidopsis thaliana | NP_190486.2 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 3.0e-24 | 64% |
RefSeq | Populus trichocarpa | XP_002331135.1 | predicted protein [Populus trichocarpa] | 2.0e-24 | 64% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P0W0
Fln msg: Distance to subject end: 219 aas, your sequence is shorter than subject: 69 - 370
Fln protein:
A
Protein Length:
70
Fln nts:
A
Fln Alignment:
AllPine_a_c48765___ALRFFEQMQLVGMQPNDITFICILSACSHVGLVNEGRNYFNSMSRNHNIKPRMEHYACMVDLLSRAGFL
A9P0W0________________AVLLFEQMLQTGVKPNQITFVVVLSGCSHAGLVDEGRNYFDSMTRDHGISPKAEHYSCMVDLFGRAGCL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain