|
||||||
|
UniGene Name: sp_v3.0_unigene112295
Length: 245 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene112295
G |
|
Ace file of the UniGene sp_v3.0_unigene112295
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ATP binding/protein serine/threonine kinase n=4 Tax=Magnoliophyta RepID=C6FF68_SOYBN | - | - | 7.0e-39 | 95% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 58% |
| Sma3 | Putative leucine-rich repeat receptor-like kinase | - | - | 7.39e-24 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Non-specific serine/threonine protein kinase. | EC:2.7.11.1 | - | 6.129e-11 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G55610; AT2G01950; AT2G02220; AT3G13380; AT4G39400; AT5G07280; AT5G53890; At1g55610; At1g70450; At2g01950; At2g02220; At3g13380; At3g26940; At4g39400; At5g07280; At5g53890; B1043F11.38; B1469H02.26; BRI1; BRL1; BRL3; Bri1; CDG1; CLL4A; CLL4B; CURL3; Ce |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | endosome membrane | GO:0010008 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | protein complex | GO:0043234 | Cellular Component | 0.0 | - |
| Sma3 | peptide receptor activity | GO:0001653 | Molecular Function | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | steroid binding | GO:0005496 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
| Sma3 | protein homodimerization activity | GO:0042803 | Molecular Function | 0.0 | - |
| Sma3 | protein heterodimerization activity | GO:0046982 | Molecular Function | 0.0 | - |
| Sma3 | microtubule bundle formation | GO:0001578 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | meiosis | GO:0007126 | Biological Process | 0.0 | - |
| Sma3 | megasporogenesis | GO:0009554 | Biological Process | 0.0 | - |
| Sma3 | microsporogenesis | GO:0009556 | Biological Process | 0.0 | - |
| Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
| Sma3 | skotomorphogenesis | GO:0009647 | Biological Process | 0.0 | - |
| Sma3 | detection of brassinosteroid stimulus | GO:0009729 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Sma3 | brassinosteroid mediated signaling pathway | GO:0009742 | Biological Process | 0.0 | - |
| Sma3 | positive regulation of flower development | GO:0009911 | Biological Process | 0.0 | - |
| Sma3 | response to UV-B | GO:0010224 | Biological Process | 0.0 | - |
| Sma3 | phloem transport | GO:0010233 | Biological Process | 0.0 | - |
| Sma3 | tapetal cell fate specification | GO:0010234 | Biological Process | 0.0 | - |
| Sma3 | brassinosteroid homeostasis | GO:0010268 | Biological Process | 0.0 | - |
| Sma3 | leaf vascular tissue pattern formation | GO:0010305 | Biological Process | 0.0 | - |
| Sma3 | tapetal layer development | GO:0048658 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Intradiol ring-cleavage dioxygenase, C-terminal | IPR000627 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | S-locus glycoprotein | IPR000858 | - | 0.0 | - |
| Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
| Sma3 | Bulb-type lectin domain | IPR001480 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Enolpyruvate transferase domain | IPR001986 | - | 0.0 | - |
| Sma3 | Apple-like | IPR003609 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat 2 | IPR013101 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
| Sma3 | PAN-2 domain | IPR013227 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Interleukin-4/interleukin-13, conserved site | IPR018096 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G01950.1 | VH1, BRL2 BRI1-like 2 chr2:440805-444236 REVERSE LENGTH=1143 | 5.60519e-45 | 91% |
| RefSeq | Arabidopsis thaliana | NP_178304.1 | serine/threonine-protein kinase BRI1-like 2 [Arabidopsis thaliana] | 8.40779e-45 | 91% |
| RefSeq | Populus trichocarpa | XP_002312487.1 | predicted protein [Populus trichocarpa] | 0.0 | 93% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LM41
Fln msg: Distance to subject end: 224 aas, your sequence is shorter than subject: 81 - 613
Fln protein:
G
Protein Length:
82
Fln nts:
G
Fln Alignment:
AllPine_a_c46245___GCGGFGEVFKATLKDGSNVAIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYMQFGSLEDML
B8LM41________________GSGRTGTVYRATLTDGSVMAIKRL-RDSAQSEKQFKAEMNTLARLRHRNLVPLLGYCIAGQEKLLVYKHMANGSLWDCL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
