|
||||||
|
UniGene Name: sp_v3.0_unigene112260
Length: 229 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene112260
T |
|
Ace file of the UniGene sp_v3.0_unigene112260
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Peroxidase 53 n=4 Tax=Brassicaceae RepID=PER53_ARATH | - | - | 1.0e-24 | 71% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 78% |
| Sma3 | Peroxidase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peroxidase. | EC:1.11.1.7 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylalanine metabolism | 00360 | 0.0 | % | |
| Sma3 | Methane metabolism | 00680 | 0.0 | % | |
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 0.0 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT3G32980; At2g18150; At2g38380; At2g38390; At3g32980; At3g49110; At3g49120; At3g50990; At4g08770; At4g08780; At5g06720; At5g06730; At5g19890; CEVI-1; Ep; F24M12.30; F28I16.40; F2K15.3; F2K15.4; F8D23.7; FBP1; FBP4; FBP5; FLXPER1; GMIPER1; GSVIVT000247170 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | response to light stimulus | GO:0009416 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | unidimensional cell growth | GO:0009826 | Biological Process | 0.0 | - |
| Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
| Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
| Sma3 | defense response to fungus | GO:0050832 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | GPCR, rhodopsin-like, 7TM | IPR000276 | - | 0.0 | - |
| Sma3 | RNA recognition motif domain | IPR000504 | - | 0.0 | - |
| Sma3 | Plant peroxidase | IPR000823 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
| Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
| Sma3 | RNA-binding protein Lupus La | IPR006630 | - | 0.0 | - |
| Sma3 | Ataxin-2, C-terminal | IPR009818 | - | 0.0 | - |
| Sma3 | Nucleotide-binding, alpha-beta plait | IPR012677 | - | 0.0 | - |
| Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
| Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G06720.1 | ATPA2, PA2 peroxidase 2 chr5:2077567-2078857 REVERSE LENGTH=335 | 3.0e-32 | 71% |
| RefSeq | Arabidopsis thaliana | NP_196290.1 | peroxidase 53 [Arabidopsis thaliana] | 3.0e-32 | 71% |
| RefSeq | Populus trichocarpa | XP_002322726.1 | predicted protein [Populus trichocarpa] | 9.0e-31 | 65% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NN21
Fln msg: Distance to subject end: 74 aas, your sequence is shorter than subject: 76 - 324
Fln protein:
V
Protein Length:
77
Fln nts:
T
Fln Alignment:
AllPine_a_c46204___VGLSVTDVVALSGGHTIGRARCTVFVNRLYNFSGTGNPDATLNSSYLSTLQSTCPQNGNGSTLTSLDPGTPNTFDN
A9NN21________________LGFSVTDVVALSGAHTIGRARCQTFSSRLYNFSGTAKPDPTLNSCYLSTLQSACPQNGNMSSITSFDPGTPNTFDN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
