|
||||||
|
UniGene Name: sp_v3.0_unigene109970
Length: 166 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene109970
T |
|
Ace file of the UniGene sp_v3.0_unigene109970 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Tetratricopeptide-like helical [Medicago truncatula] | - | - | 1.0e-14 | 77% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 81% |
| Sma3 | Pentatricopeptide (PPR) repeat-containing protein-like | - | - | 5.467e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g11290; At1g20230; At1g56690; At2g02980; At2g15690; At2g22070; At3g02010; At3g24000; At3g26782; At3g49170; At3g49710; At4g02750; At4g16835; At4g18750; At4g33170; At4g33990; At4g37380; At5g09950; At5g46460; B1032F05.19; B1080A02.28; DYW10; EMB2261; EMB2 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | phloem or xylem histogenesis | GO:0010087 | Biological Process | 0.0 | - |
| Sma3 | leaf vascular tissue pattern formation | GO:0010305 | Biological Process | 0.0 | - |
| Sma3 | cotyledon vascular tissue pattern formation | GO:0010588 | Biological Process | 0.0 | - |
| Sma3 | mRNA modification | GO:0016556 | Biological Process | 0.0 | - |
| Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | C-5 cytosine methyltransferase | IPR001525 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
| Sma3 | MAP kinase, conserved site | IPR003527 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF659 | IPR007021 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | IPR011523 | - | 0.0 | - | |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Thioredoxin, conserved site | IPR017937 | - | 0.0 | - |
| Sma3 | IPR018115 | - | 0.0 | - | |
| Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G49170.1 | EMB2261 Tetratricopeptide repeat (TPR)-like superfamily protein chr3:18226954-18229600 REVERSE LENGTH=850 | 2.0e-19 | 75% |
| RefSeq | Arabidopsis thaliana | NP_190486.2 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-19 | 75% |
| RefSeq | Populus trichocarpa | XP_002303271.1 | predicted protein [Populus trichocarpa] | 1.0e-19 | 72% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: your sequence is shorter than subject: 45 - 246
Fln protein:
L
Protein Length:
46
Fln nts:
T
Fln Alignment:
AllPine_a_c43387___LRVCGDCHDAIKFISAIVGREIVLRDANRFHHFSDGLCSCGGYW
D5AAE0________________LRVCGDCHTATKFISKIVEREIIIRDANRFHHFKDGLCSCGDYW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
