UniGene Name: sp_v3.0_unigene107587
Length: 171 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene107587
T |
Ace file of the UniGene sp_v3.0_unigene107587
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Phytochrome n=12 Tax=Pinaceae RepID=PHY_PICAB | - | - | 9.0e-20 | 94% |
| FL-Next | sp=Phytochrome; Picea abies (Norway spruce) (Picea excelsa). | - | - | 0.0 | 94% |
| Sma3 | Phytochrome C | - | - | 7.375e-29 | - |
| Source | Gene names |
|---|---|
| Sma3 | CpPHY2; GSVIVT00003388001; GSVIVT00029101001; GSVIVT00033144001; PHY; PHY1; PHY2; PHY3; PHY4; PHY5a; PHY5b; PHY5c; PHYA; PHYA1; PHYB; PHYB1; PHYC; PHYE; PHYO; PHYP; PHYPADRAFT_115388; PHYPADRAFT_165601; PHYPADRAFT_185248; PHYPADRAFT_208532; PHYPADRAFT_218 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | two-component sensor activity | GO:0000155 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | G-protein coupled photoreceptor activity | GO:0008020 | Molecular Function | 0.0 | - |
| Sma3 | protein homodimerization activity | GO:0042803 | Molecular Function | 0.0 | - |
| Sma3 | two-component signal transduction system (phosphorelay) | GO:0000160 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
| Sma3 | sensory perception | GO:0007600 | Biological Process | 0.0 | - |
| Sma3 | red, far-red light phototransduction | GO:0009585 | Biological Process | 0.0 | - |
| Sma3 | protein-tetrapyrrole linkage | GO:0017006 | Biological Process | 0.0 | - |
| Sma3 | peptidyl-histidine phosphorylation | GO:0018106 | Biological Process | 0.0 | - |
| Sma3 | protein-chromophore linkage | GO:0018298 | Biological Process | 0.0 | - |
| Sma3 | response to stimulus | GO:0050896 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G18790.1 | PHYB, HY3, OOP1 phytochrome B chr2:8140079-8144151 FORWARD LENGTH=1172 | 1.0e-13 | 75% |
| RefSeq | Arabidopsis thaliana | NP_179469.1 | phytochrome B [Arabidopsis thaliana] | 1.0e-13 | 75% |
| RefSeq | Populus trichocarpa | XP_002312330.1 | predicted protein [Populus trichocarpa] | 3.0e-13 | 78% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q40762
Fln msg: ERROR#3, very serious frame error, Overlapping hits, possible frame ERROR between 58 and 58, Distance to subject end: 615 aas, your sequence is shorter than subject: 57 - 1136
Fln protein:
G
Protein Length:
58
Fln nts:
T
Fln Alignment:
AllPine_a_c39941___GKRLWRLGTTPTEAQILDISDWLLEHHRDSTGLSTDSLAEAGYPGAASLGDAVCGIS
Q40762________________GKRLWLLGTTPTEAQILDIADWLLEHHRDSTGLSTDSLAEAGYPGAASLGDAVCGIA

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta