UniGene Name: sp_v3.0_unigene106862
Length: 112 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene106862
T |
Ace file of the UniGene sp_v3.0_unigene106862 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Receptor protein kinase-like protein n=1 Tax=Capsicum annuum RepID=Q8VZH5_CAPAN | - | - | 3.0e-11 | 88% |
FL-Next | sp=Receptor-like protein kinase FERONIA; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 80% |
Sma3 | FERONIA receptor-like kinase | - | - | 1.009e-19 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 5.081e-07 | - |
Source | Gene names |
---|---|
Sma3 | AT4g39110; At2g21480; At3g04690; At3g46290; At3g51550; At4g39110; At5g28680; At5g54380; At5g59700; At5g61350; B1143G03.32; F12M12.260; F18L15.10; F19H22.210; F26O13.190; F7O18.16; FER; GSVIVT00016292001; GSVIVT00023386001; GSVIVT00024420001; GSVIVT0002761 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | protein autophosphorylation | GO:0046777 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G51550.1 | FER Malectin/receptor-like protein kinase family protein chr3:19117877-19120564 REVERSE LENGTH=895 | 1.0e-13 | 80% |
RefSeq | Arabidopsis thaliana | NP_190723.1 | receptor-like protein kinase FERONIA [Arabidopsis thaliana] | 1.0e-13 | 80% |
RefSeq | Populus trichocarpa | XP_002323088.1 | predicted protein [Populus trichocarpa] | 7.0e-14 | 83% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9SCZ4
Fln msg: Distance to subject end: 316 aas, your sequence is shorter than subject: 36 - 895
Fln protein:
I
Protein Length:
37
Fln nts:
T
Fln Alignment:
AllPine_a_c38855___IGVGGFGKVYQGEIDGG-TKVAVKRGNPLSEQGINE
Q9SCZ4________________LGVGGFGKVYRGEIDGGTTKVAIKRGNPMSEQGVHE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain