SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene105875

Length: 364 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene105875
CGTCGTGACCTTGGCTGTCACTCATCTTATTTCACTACGCCTGGATTGCTTGGATGGGCACTCCGGTTTGGTTACTGGGCAGCTCAGGGGTCCGTTCTGTTTGGTATATGGGTTATAGCACATGAATGCGGGCATCATGCATTTAGTGACTACTCTTTGGTGGACGATACGGTGGGGCTTATACTACACTCATGGCTTCTTGTACCATATTTCTCCTGGAAATACAGTCATCGAAGACATCACAGCAACACTGGGAGTTTAGAACGAGATGAAGCTTATGTTCCCCGGACAAAGAATGATATGATAAAGTGGACTTCCGCTCTGGTACGTAACCCTCTGGGAAGGTTGTTGATGATAGCAATTT

Ace file of the UniGene sp_v3.0_unigene105875 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Omega-6 fatty acid desaturase n=1 Tax=Cucurbita pepo RepID=Q6QUM6_CUCPE	-	-	1.0e-39	67%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	77%
Sma3	Delta-12 fatty acid desaturase	-	-	5.325e-40	-

Source	ECs	Term	Type	e value	Identity
Sma3	Oxidoreductases, Acting on paired donors, with incorporation or reduction of molecular oxygen, With oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water.	EC:1.14.19.-	-	3.388e-13	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	alpha-Linolenic acid metabolism	00592		3.388e-13	%
Sma3	Biosynthesis of unsaturated fatty acids	01040		3.388e-13	%
Sma3	Delta(12)-fatty acid dehydrogenase.	EC:1.14.99.33	-	1.878e-09	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Linoleic acid metabolism	00591		1.878e-09	%
Sma3	Phosphatidylcholine desaturase.	EC:1.3.1.35	-	1.343e-10	-

Source	Gene names
Sma3	At2g29980; At3g12120; CHLREDRAFT_135825; CvFad2; ELI12; ELI7.1; ELI7.2; ELI7.4; ELI7.5; ELI7.6; ELI7.7; ELI7.8; ELI7.9; F23F1.10; FAD; FAD12; FAD2; FAD2-1; FAD2-1A; FAD2-1B; FAD2-2; FAD2-3; FAD2-4; FAD2B; FAD3; FADX; Fad2; Fad3; FadS; FadX; GSVIVT00023110

Source	GOs	Term	Type	Identity
Sma3	endoplasmic reticulum membrane	GO:0005789	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	stearoyl-CoA 9-desaturase activity	GO:0004768	Molecular Function	-
Sma3	iron ion binding	GO:0005506	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	delta12-fatty acid dehydrogenase activity	GO:0016720	Molecular Function	-
Sma3	omega-3 fatty acid desaturase activity	GO:0042389	Molecular Function	-
Sma3	omega-6 fatty acid desaturase activity	GO:0045485	Molecular Function	-
Sma3	phosphatidylcholine desaturase activity	GO:0050184	Molecular Function	-
Sma3	lipid metabolic process	GO:0006629	Biological Process	-
Sma3	fatty acid biosynthetic process	GO:0006633	Biological Process	-
Sma3	unsaturated fatty acid biosynthetic process	GO:0006636	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	e value	Identity
Sma3	Fatty acid desaturase, type 1	IPR005804	-	0.0	-

Source	Species	ID	Description	Identity
ATG	Arabidoptis thaliana	AT3G12120.1	FAD2 fatty acid desaturase 2 chr3:3860592-3861743 REVERSE LENGTH=383	70%
RefSeq	Arabidopsis thaliana	NP_001078140.1	omega-6 fatty acid desaturase, endoplasmic reticulum [Arabidopsis thaliana]	70%
RefSeq	Populus trichocarpa	XP_002309307.1	predicted protein [Populus trichocarpa]	72%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9NUQ3

Fln msg: Distance to subject end: 197 aas, your sequence is shorter than subject: 121 - 375

Fln protein: RRDLGCHSSYFTTPGLLGWALRFGYWAAQGSVLFGIWVIAHECGHHAFSDYSLVDDTVGLILHSWLLVPYFSWKYSHRRHHSNTGSLERDEAYVPRTKNDMIKWTSALVRNPLGRLLMIAI

Protein Length: 122

Fln nts: CGTCGTGACCTTGGCTGTCACTCATCTTATTTCACTACGCCTGGATTGCTTGGATGGGCACTCCGGTTTGGTTACTGGGCAGCTCAGGGGTCCGTTCTGTTTGGTATATGGGTTATAGCACATGAATGCGGGCATCATGCATTTAGTGACTACTCTTTGGTGGACGATACGGTGGGGCTTATACTACACTCATGGCTTCTTGTACCATATTTCTCCTGGAAATACAGTCATCGAAGACATCACAGCAACACTGGGAGTTTAGAACGAGATGAAGCTTATGTTCCCCGGACAAAGAATGATATGATAAAGTGGACTTCCGCTCTGGTACGTAACCCTCTGGGAAGGTTGTTGATGATAGCAATTT

Fln Alignment:

AllPine_a_c37511___YFTTPGLLGWALRFGYWAAQGSVLFGIWVIAHECGHHAFSDYSLVDDTVGLILHSWLLVPYFSWKYSHRRHHSNTGSLERDEAYVPRTKNDMIKWTSALVRNPLGRLLMIAI
A9NUQ3________________YFTMSGILGWALWLGYWAAQGSVLTGVWVIAHECGHHAFSDFSWVDDTVGLIFHSCLLVPYFSWKYSHRRHHSNTGSLERDEVFVPKPKNE-LKWTSKVLSNPPGRLLTIGI

SNPs (tot: 7)

Position	A %	C %	G %	T %	Probability
238	33		66		0.997452
263		66	33		0.997452
275		33	66		0.997452
284	33		66		0.997452
303	33		66		0.997452
329		33	66		0.997452
330		33		66	0.997452

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain