UniGene Name: sp_v3.0_unigene99309
Length: 214 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene99309
T |
Ace file of the UniGene sp_v3.0_unigene99309 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pentatricopeptide repeat-containing protein, putative n=1 Tax=Ricinus communis RepID=B9STP1_RICCO | - | - | 5.0e-18 | 62% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 68% |
| Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 1.938e-13 | - |
| Source | Gene names |
|---|---|
| Sma3 | A_TM021B04.2; At1g06140; At1g20230; At2g13600; At3g22150; At4g01030; At4g02750; At5g15340; At5g19020; At5g27110; B1045D11.23; B1130E07.12; F3I3.50; F8M21_230; GSVIVT00000117001; GSVIVT00000138001; GSVIVT00002423001; GSVIVT00006499001; GSVIVT00006853001; G |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
| Sma3 | lipid binding | GO:0008289 | Molecular Function | 0.0 | - |
| Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | lipid transport | GO:0006869 | Biological Process | 0.0 | - |
| Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
| Sma3 | methylation | GO:0032259 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G27110.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr5:9538572-9540647 REVERSE LENGTH=691 | 4.0e-22 | 58% |
| RefSeq | Arabidopsis thaliana | NP_198063.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 5.0e-22 | 58% |
| RefSeq | Populus trichocarpa | XP_002324074.1 | predicted protein [Populus trichocarpa] | 5.0e-23 | 62% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADG9
Fln msg: Distance to subject end: 209 aas, your sequence is shorter than subject: 70 - 312
Fln protein:
Q
Protein Length:
71
Fln nts:
T
Fln Alignment:
AllPine_a_c21540___QQADIKPDSITLTGVLSACSHAGLVDEGWKYFECMRQDYHITPCLEHYACMVDILGRAGHLYEAECLIHK
D5ADG9_______________QQRGVKPNEITFISVLSACSHAGLVDEGWKCYNCMTLDYAITPTVEHYACMVDLLGRAGHLNEAWDFIEK

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)