UniGene Name: sp_v3.0_unigene98385
Length: 230 nt
UniGene Fasta |
---|
>sp_v3.0_unigene98385
T |
Ace file of the UniGene sp_v3.0_unigene98385 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative serine/threonine protein kinase [Arabidopsis thaliana] | - | - | 5.0e-14 | 72% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 91% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific serine/threonine protein kinase. | EC:2.7.11.1 | - | 9.363e-08 | - |
Source | Gene names |
---|---|
Sma3 | AUR1; AUR2; AUR3; At2g25880; At2g45490; At4g32830; F17H15.9; F17K2.2; GSVIVT00032134001; LOC_Os03g55620; OSJNBa0079B15.25; Os01g0191800; Os03g0765000; OsAUR1; OsAUR2; OsI_00731; OsI_13651; OsJ_00707; OsJ_12700; P0671B11.4; P0710E05.39; PHYPADRAFT_191512; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromosome, centromeric region | GO:0000775 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | spindle | GO:0005819 | Cellular Component | 0.0 | - |
Sma3 | nuclear membrane | GO:0031965 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | histone kinase activity (H3-S10 specific) | GO:0035175 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | histone phosphorylation | GO:0016572 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G32830.1 | AtAUR1, AUR1 ataurora1 chr4:15842557-15844354 FORWARD LENGTH=294 | 2.0e-19 | 72% |
RefSeq | Arabidopsis thaliana | NP_195009.1 | serine/threonine-protein kinase aurora-1 [Arabidopsis thaliana] | 3.0e-19 | 72% |
RefSeq | Populus trichocarpa | XP_002308590.1 | predicted protein [Populus trichocarpa] | 6.0e-21 | 79% |
Full-Lengther Next Prediction |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NRB9
Fln msg: query STOP codon is far from subject stop. Distance to subject end: 20 aas, your sequence is shorter than subject: 62 - 300
Fln protein:
S
Protein Length:
63
Fln nts:
T
Fln Alignment:
AllPine_a_c19515___YEFLYGIPPFEAKKHSDTYRRIVKIDLKFPPTPAVSDAAKDLIRQVSV
A9NRB9_______________YEFLYGIPPFEAKKHSDTYRRIIKIDLKFPPTPVVSDAAKDLIRQILV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain