SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene97932

Length: 559 nt

UniGene Fasta

>sp_v3.0_unigene97932
CGTCGTGACCTTGGCTGTCACTCATCCTATGGCTACATTGCTCCAGAATATGCCTACACACTTCAAGTCTTTGAGAAAAGTGACATATACAGCTTTGGGGTGGTCCTCTTAGAGCTCTTGACCGGACGTCTGCCCTTGGGTCCTGAATTTGGAGAAGGTGTCAACATTGTGGACTGGGTCAAGGAAAGAGTTCAGACCAAGGAAGGGATGGAAAAGATCTTAGATCAAAGTGTTAGAGTTCCAAGTTTCTCAGTCAAGGAAGAGATGATGCTGGTCCTCAGAGTGGCTCTCCTCTGCACTAGTAGGTCTCCAGTCAACCGACCATCGATGAGAGATGTTGTTTCAATGTTATCAGAAGCCCACTCCAAAAGCAAAGCAGCCCTTGACACCCAATCCTTGCAACAACACAGGTCCCATTCTTCATCTCAGCCAGACAGTCCACCACGCTGTTCTAAGGAAGGAAGCCAACATTAAATATGTTTCCATTGAAGTAAACGTTGTTGGGTATGTTCGTGTTATGAGCTTTTTGGTGATGATCGACATATGTTTATTTTATCTA

Ace file of the UniGene sp_v3.0_unigene97932

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	putative leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] sp\|Q9FII5.1\|TDR_ARATH RecName: Full=Leucine-rich repeat receptor-like protein kinase TDR; AltName: Full=Protein PHLOEM INTERCALATED WITH XYLEM; AltName: Full=Tracheary elemen	-	-	6.0e-29	53%
FL-Next	tr=Clavata-like receptor; Picea glauca (White spruce) (Pinus glauca).	-	-	0.0	61%
Sma3	Receptor protein kinase CLAVATA1, putative	-	-	8.35e-29	-

Source	ECs	Term	Type	e value	Identity
Sma3	2-alkenal reductase.	EC:1.3.1.74	-	2.391e-25	-
Sma3	Mitogen-activated protein kinase kinase kinase.	EC:2.7.11.25	-	5.245e-18	-

Source	Gene names
Sma3	AT1G08590; AT1G28440; AT1G34110; AT1G75820; AT2G41820; AT3G49670; AT4G20270; AT4G28490; AT4G28650; AT4g20270; AT5G48940; AT5G49660; AT5G61480; AT5G63930; AT5G65700; AT5G65710; At1g08590; At1g17230; At1g28440; At1g72180; At1g75820; At2g41820; At3g19700; At

Source	GOs	Term	Type	Identity
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	aminopeptidase activity	GO:0004177	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	protein tyrosine kinase activity	GO:0004713	Molecular Function	-
Sma3	receptor activity	GO:0004872	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	identical protein binding	GO:0042802	Molecular Function	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	regulation of meristem structural organization	GO:0009934	Biological Process	-
Sma3	endosperm development	GO:0009960	Biological Process	-
Sma3	regulation of meristem growth	GO:0010075	Biological Process	-
Sma3	microsporocyte differentiation	GO:0010480	Biological Process	-
Sma3	cell differentiation	GO:0030154	Biological Process	-
Sma3	interspecies interaction between organisms	GO:0044419	Biological Process	-
Sma3	protein autophosphorylation	GO:0046777	Biological Process	-
Sma3	gametophyte development	GO:0048229	Biological Process	-
Sma3	floral organ development	GO:0048437	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Alpha/beta hydrolase fold-1	IPR000073	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Enolpyruvate transferase domain	IPR001986	-	-
Sma3	Peptidase S33	IPR002410	-	-
Sma3	Aminotransferases, class-I, pyridoxal-phosphate-binding site	IPR004838	-	-
Sma3	Carbamoyl-phosphate synthetase, large subunit, ATP-binding	IPR005479	-	-
Sma3	Proline iminopeptidase	IPR005944	-	-
Sma3	Phosphopantetheine attachment site	IPR006162	-	-
Sma3	Tyrosine-protein kinase, active site	IPR008266	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Leucine-rich repeat-containing N-terminal, type 2	IPR013210	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	HTH domain AraC-type, conserved site	IPR018062	-	-
Sma3	Aldo/keto reductase, conserved site	IPR018170	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G61480.1	PXY Leucine-rich repeat protein kinase family protein chr5:24724541-24727842 REVERSE LENGTH=1041	4.0e-34	59%
RefSeq	Arabidopsis thaliana	NP_200956.1	putative leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana]	5.0e-34	59%
RefSeq	Populus trichocarpa	XP_002303493.1	predicted protein [Populus trichocarpa]	6.0e-36	61%

Full-Lengther Next Prediction

Fln status: C-terminus

Fln database: coniferopsida.fasta

Fln subject: Q19AV8

Fln msg: your sequence is shorter than subject: 158 - 998

Fln protein: RRDLGCHSSYGYIAPEYAYTLQVFEKSDIYSFGVVLLELLTGRLPLGPEFGEGVNIVDWVKERVQTKEGMEKILDQSVRVPSFSVKEEMMLVLRVALLCTSRSPVNRPSMRDVVSMLSEAHSKSKAALDTQSLQQHRSHSSSQPDSPPRCSKEGSQH*

Protein Length: 159

Fln nts: CGTCGTGACCTTGGCTGTCACTCATCCTATGGCTACATTGCTCCAGAATATGCCTACACACTTCAAGTCTTTGAGAAAAGTGACATATACAGCTTTGGGGTGGTCCTCTTAGAGCTCTTGACCGGACGTCTGCCCTTGGGTCCTGAATTTGGAGAAGGTGTCAACATTGTGGACTGGGTCAAGGAAAGAGTTCAGACCAAGGAAGGGATGGAAAAGATCTTAGATCAAAGTGTTAGAGTTCCAAGTTTCTCAGTCAAGGAAGAGATGATGCTGGTCCTCAGAGTGGCTCTCCTCTGCACTAGTAGGTCTCCAGTCAACCGACCATCGATGAGAGATGTTGTTTCAATGTTATCAGAAGCCCACTCCAAAAGCAAAGCAGCCCTTGACACCCAATCCTTGCAACAACACAGGTCCCATTCTTCATCTCAGCCAGACAGTCCACCACGCTGTTCTAAGGAAGGAAGCCAACATTAA___ATATGTTTCCATTGAAGTAAACGTTGTTGGGTATGTTCGTGTTATGAGCTTTTTGGTGATGATCGACATATGTTTATTTTATCTA

Fln Alignment:

AllPine_a_c18800___SYGYIAPEYAYTLQVFEKSDIYSFGVVXXXXXXXXXXXXXXFGEGVNIVDWVKERVQTKEGMEKILDQSVRVPSFSVKEEMMLVLRVALLCTSRSPVNRPSMRDVVSMLSEA--HSKSKA
Q19AV8_______________SYGYIAPEYAYTLKVNEKSDIYSFGVVILELVTGRRPVDPEFGENKDLVKWLCNKIEKKNGLHEVLDPKL-VDCF--KEEMTMVMRVGLLCTSVLPINRPSMRRVVEMLQEANPHHKAKA

SNPs (tot: 35)

Position	A %	C %	G %	T %	Probability
286	75	25			0.996481
289		25	75		0.996481
293		75	25		0.996481
294	25			75	0.996481
298		66		33	0.997452
299			33	66	0.997452
302	66			33	0.997452
303		66	33		0.997452
307		33	66		0.997452
309	66	33			0.997452
310	33		66		0.997452
333	80			20	0.995496
334		20		80	0.995496
336	80			20	0.995496
339		20	80		0.995499
340	80	20			0.995499
344			25	75	0.996473
348			20	80	0.995505
352	75	25			0.996473
354		25	75		0.996473
355	25			75	0.996473
376	66			33	0.997452
377	25		75		0.99649
378		75		25	0.996481
380	66			33	0.997452
381	66	33			0.997452
385	75	25			0.996481
386			75	25	0.996481
387		66		33	0.997452
388		66	33		0.997452
389		66	33		0.997452
390		33		66	0.997452
393	66			33	0.997452
395	66			33	0.997452
397		66		33	0.997452

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain