SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene94526

Length: 366 nt

UniGene Fasta

>sp_v3.0_unigene94526
ACTTCCTTGGGGGAGTCTGCTTTGAACACAACGACTTCCAACAAGAGTTCCTCCAGACAGCCCTCTGGCACCTTCATGGTTTAGATTGGAAGGTGATGGTAGAGTCAAAGGTGATATTATGCTTGCGGTTTGGATGGGAACACAGGCAGACGAAACATTCCCAGAGGCTTGGCAGTCTGATACAGGAGGTATGATGAATACAAGATCAAAAGTATATTTGTCCCCAAAATTATGGTATCTGAGGGTCAATGTAATTGAAGCCCAAGACTTGCAGATTCCTGAAAAGGCAAATCTTCCTGAACTGAAAGTGAGGGTGCAGTTGGGTATGCAGGTTTTGAGGACTAGAACTTCTAATTCTAGAACCTT

Ace file of the UniGene sp_v3.0_unigene94526

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Unassigned protein	-	-	0.0	-
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	64%
Sma3	Synaptotagmin, putative	-	-	1.462e-24	-

Source	Gene names
Sma3	AT4g11610; AT4g20080; At1g04150; At1g22610; At1g51570; At1g74720; At3g03680; At3g57880; At3g61300; At4g00700; At4g11610; At4g11620; At4g20080; At5g06850; At5g12970; At5g17980; At5g44760; At5g48060; F12K8.4; F19C24.20; F1M20.40; F20D22.8; F25A4.30; GSVIVT0

Source	GOs	Term	Type	Identity
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	endoplasmic reticulum	GO:0005783	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	glutathione peroxidase activity	GO:0004602	Molecular Function	-
Sma3	transferase activity	GO:0016740	Molecular Function	-
Sma3	transferase activity, transferring glycosyl groups	GO:0016757	Molecular Function	-
Sma3	response to oxidative stress	GO:0006979	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	C2 calcium-dependent membrane targeting	IPR000008	-	-
Sma3	Glutathione peroxidase	IPR000889	-	-
Sma3	Sugar transporter, conserved site	IPR005829	-	-
Sma3	Molybdopterin oxidoreductase, prokaryotic, conserved site	IPR006655	-	-
Sma3	Protein of unknown function DUF1118	IPR009500	-	-
Sma3		IPR012335	-	-
Sma3	Phosphoribosyltransferase C-terminal	IPR013583	-	-
Sma3	C2 membrane targeting protein	IPR018029	-	-
Sma3	Hemopexin/matrixin, conserved site	IPR018486	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G51570.1	Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein chr1:19122358-19124688 REVERSE LENGTH=776	8.00001e-42	65%
RefSeq	Arabidopsis thaliana	NP_175568.1	anthranilate phosphoribosyltransferase-like protein [Arabidopsis thaliana]	9.99967e-42	65%
RefSeq	Populus trichocarpa	XP_002298449.1	predicted protein [Populus trichocarpa]	1.96182e-44	64%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LL63

Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 536 aas, your sequence is shorter than subject: 121 - 758

Fln protein: LPWGSLL*TQRLPTRVPPDSPLAPSWFRLEGDGRVKGDIMLAVWMGTQADETFPEAWQSDTGGMMNTRSKVYLSPKLWYLRVNVIEAQDLQIPEKANLPELKVRVQLGMQVLRTRTSNSRT

Protein Length: 122

Fln nts: ACTTCCTTGGGGGAGTCTGCTTTGAACACAACGACTTCCAACAAGAGTTCCTCCAGACAGCCCTCTGGCACCTTCATGGTTTAGATTGGAAGGTGATGGTAGAGTCAAAGGTGATATTATGCTTGCGGTTTGGATGGGAACACAGGCAGACGAAACATTCCCAGAGGCTTGGCAGTCTGATACAGGAGGTATGATGAATACAAGATCAAAAGTATATTTGTCCCCAAAATTATGGTATCTGAGGGTCAATGTAATTGAAGCCCAAGACTTGCAGATTCCTGAAAAGGCAAATCTTCCTGAACTGAAAGTGAGGGTGCAGTTGGGTATGCAGGTTTTGAGGACTAGAACTTCTAATTCTAGAACCTT

Fln Alignment:

AllPine_a_c9980___LPTRVPPDSPLAPSWFRLE---GDGRVKGDIMLAVWMGTQADETFPEAWQSDTG-----GMMNTRSKVYLSPKLWYLRVNVIEAQDLQIPEKANLPELKVRVQLGMQVLRTR
B8LL63_______________VPTRVPPDSPLAPQWYRLEDKKGEGKVKGELMLAVWLGTQADEAFSEAWHSDAAAVHSDGLVNTRSKVYLSPKLWYVRVNVIEAQDLIPSDKTKFPDFQVKVQLGNQTGKTK

SNPs (tot: 27)

Position	A %	C %	G %	T %	Probability
26	83			16	0.994523
28	83			16	0.994523
30	83			16	0.994523
31	83	16			0.994523
32		83	16		0.994523
36		83	16		0.994523
47	83		16		0.994516
65		16		83	0.994517
66		80		20	0.995493
86	80		20		0.995493
87		20		80	0.995493
98		20		80	0.995493
123	14	85			0.993534
124	14			85	0.993534
127		85		14	0.993534
146	33		66		1.0
152		66		33	1.0
192	66		33		1.0
239		50		50	1.0
248		50		50	1.0
252	50		50		1.0
288	33		66		0.997453
289		66		33	0.997476
294		66		33	0.997476
299		33		66	0.997459
305		33	66		0.997464
321		33		66	0.997476

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain