|
||||||
|
UniGene Name: sp_v3.0_unigene81460
Length: 219 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene81460
G |
|
Ace file of the UniGene sp_v3.0_unigene81460
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | pfam02458, Transferase, Transferase family | - | - | 2.0e-20 | 45% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
| Sma3 | Transferase family protein | - | - | 1.401e-17 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Taxadien-5-alpha-ol O-acetyltransferase. | EC:2.3.1.162 | - | 8.173e-13 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Diterpenoid biosynthesis | 00904 | 8.173e-13 | % | |
| Sma3 | 10-deacetylbaccatin III 10-O-acetyltransferase. | EC:2.3.1.167 | - | 2.293e-10 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Diterpenoid biosynthesis | 00904 | 2.293e-10 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 2.293e-10 | % | |
| Sma3 | Metabolic pathways | 01100 | 2.293e-10 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.293e-10 | % |
| Source | Gene names |
|---|---|
| Sma3 | AAT; AAT1; AAT2; AAT3; AT2; At3g03480; At3g62160; At5g17540; B1033B05.17; B1051E10.34; B1123E10.118; BAPT; CtAT23; DBAT; DBTNBT; GSVIVT00001202001; GSVIVT00003212001; GSVIVT00003215001; GSVIVT00003217001; GSVIVT00003220001; GSVIVT00009436001; GSVIVT000138 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | alcohol O-acetyltransferase activity | GO:0004026 | Molecular Function | 0.0 | - |
| Sma3 | GO:0008415 | Molecular Function | 0.0 | - | |
| Sma3 | acetyl CoA:(Z)-3-hexen-1-ol acetyltransferase activity | GO:0010327 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity, transferring acyl groups other than amino-acyl groups | GO:0016747 | Molecular Function | 0.0 | - |
| Sma3 | taxadien-5-alpha-ol O-acetyltransferase activity | GO:0050638 | Molecular Function | 0.0 | - |
| Sma3 | 2-alpha-hydroxytaxane 2-O-benzoyltransferase activity | GO:0050642 | Molecular Function | 0.0 | - |
| Sma3 | 10-deacetylbaccatin III 10-O-acetyltransferase activity | GO:0050643 | Molecular Function | 0.0 | - |
| Sma3 | green leaf volatile biosynthetic process | GO:0010597 | Biological Process | 0.0 | - |
| Sma3 | paclitaxel biosynthetic process | GO:0042617 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Transferase | IPR003480 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G17540.1 | HXXXD-type acyl-transferase family protein chr5:5782061-5783682 REVERSE LENGTH=461 | 1.0e-24 | 64% |
| RefSeq | Arabidopsis thaliana | NP_197256.1 | HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana] | 1.0e-24 | 64% |
| RefSeq | Populus trichocarpa | XP_002325454.1 | predicted protein [Populus trichocarpa] | 7.0e-28 | 67% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLR5
Fln msg: Distance to subject end: 319 aas, your sequence is shorter than subject: 73 - 448
Fln protein:
E
Protein Length:
74
Fln nts:
G
Fln Alignment:
GDTE5QK01ETT4T___EDPARVIREALAKVLVLYYPFAGRLREAAAGKLAVDCTGEGVLFVEADADVALEDFGDLRPPFPGWDDLMHDV
B8LLR5_______________EDPARVIREGLAKALVFYYPFAGRLRDAPAGKLVVDCTGEGVLFVEADADVALEEFGDLQPPFPCWEDLLHDV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
