|
||||||
|
UniGene Name: sp_v3.0_unigene81401
Length: 206 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene81401
A |
|
Ace file of the UniGene sp_v3.0_unigene81401 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | peroxidase [Mirabilis jalapa] | - | - | 1.0e-17 | 65% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 65% |
| Sma3 | Secretory peroxidase | - | - | 1.646e-14 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peroxidase. | EC:1.11.1.7 | - | 1.585e-17 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylalanine metabolism | 00360 | 1.585e-17 | % | |
| Sma3 | Methane metabolism | 00680 | 1.585e-17 | % | |
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 1.585e-17 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 1.585e-17 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.585e-17 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.585e-17 | % |
| Source | Gene names |
|---|---|
| Sma3 | At2g37130; CP; GSVIVT00010753001; GSVIVT00023167001; Os07g0694300; OsI_27449; OsJ_11374; P0627E10.8; P21; PER; PER21; PER42; PO1; PO2; POD6; POPTRDRAFT_589413; POPTRDRAFT_647567; Prx2; Prx2b; RCOM_0904610; RCOM_1357540; T2N18.11; VITISV_039918; prx; prx11 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
| Sma3 | rhythmic process | GO:0048511 | Biological Process | 0.0 | - |
| Sma3 | defense response to fungus | GO:0050832 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Plant peroxidase | IPR000823 | - | 0.0 | - |
| Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
| Sma3 | Plant ascorbate peroxidase | IPR002207 | - | 0.0 | - |
| Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
| Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G37130.1 | Peroxidase superfamily protein chr2:15598225-15600004 REVERSE LENGTH=327 | 7.0e-23 | 58% |
| RefSeq | Arabidopsis thaliana | NP_001118461.1 | peroxidase [Arabidopsis thaliana] | 8.0e-23 | 58% |
| RefSeq | Populus trichocarpa | XP_002326343.1 | predicted protein [Populus trichocarpa] | 9.0e-24 | 68% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NNP1
Fln msg: Distance to subject end: 28 aas, your sequence is shorter than subject: 68 - 342
Fln protein:
N
Protein Length:
69
Fln nts:
A
Fln Alignment:
GDTE5QK01BF1G6___VLYARNDRVTPMKLDNNYFKNLIKHEGLLLVDQGLLSDSRTTPYVTKMAQDNNYFFAQFSRAFTIL
A9NNP1_______________VQYVRNDRGTPMKLDNNYYVNLMNNKGLLIVDQQLYADSRTRPYVKKMAKSQDYFFKYFARALTIL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
